Zero Charisma

Zero Charisma

Year: 2013

Runtime: 86 min

Language: English

Directors: Andrew Matthews, Katie Graham

Comedy

A self-proclaimed grand master of a fantasy board game faces a challenge when a charismatic newcomer threatens his authority. As the stakes rise, the eccentric group descends into chaos, forcing the beleaguered leader to confront his own insecurities and find a way to adapt and maintain control. He must navigate the escalating conflict and the dynamics of the group to survive.

Warning: spoilers below!

Haven’t seen Zero Charisma yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Zero Charisma (2013)

Trace every key event in Zero Charisma (2013) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Scott Weidemeyer's Routine

Scott Weidemeyer, a grumpy delivery driver, finds solace in his weekly tabletop game nights. These gatherings serve as a much-needed escape from his otherwise unfulfilling life, providing him with a structure and camaraderie that he craves.

2

Challenge of Finding a Replacement

When a player unexpectedly leaves the game to repair his marriage, Scott is faced with the daunting task of finding a suitable replacement. The need for a new player intensifies his frustrations about his social circle and his own self-worth.

3

Meeting Miles

Scott meets Miles, a laid-back hipster who quickly charms Scott's friends with his easy-going nature. Although Miles appears to fit in effortlessly, Scott remains defensive and envious of Miles' perceived advantages in life, such as his successful website and attractive girlfriend.

4

Grandmother's Stroke

The delicate dynamic of Scott's game nights is disrupted when his grandmother, Wanda, suffers a stroke. This event brings Scott's estranged mother, Barbara, back into his life, along with her new partner Bob, forcing Scott to confront unresolved feelings of abandonment.

Scott's grandmother's home
5

Conflict with Barbara

During a game night, Scott's mother disrupts the evening, humiliating him in front of his friends. This leads to a heated confrontation, causing the group to consider moving their next game night to Miles' home, deepening Scott's jealousy and frustration.

Game night location
6

Attempt to Reclaim Authority

Feeling threatened by Miles' presence, Scott lies about writing *The Matrix* as a child, believing it will reestablish his position as the dominant figure in the group. However, Miles easily debunks this claim, leaving Scott feeling more insecure and angry.

7

Emotional Meltdown

In a fit of anger, Scott attempts to cheat during a game, unable to handle the pressure of his friends sidelining him for Miles. This dramatic outburst showcases his deteriorating grip on the situation and distances him further from his friends.

8

Heartbreaking News

Scott learns that his mother intends to sell his grandmother's cherished home to settle debts. This revelation ignites a fierce confrontation between Scott and Wanda, revealing his resentment and frustration as he realizes he won't inherit the property.

Scott's grandmother's home
9

Visit to the Gaming Shop

Desperate for guidance, Scott visits a local game shop to reconnect with his idol, Greg Goran. The encounter spirals out of control as Scott misinterprets Greg's advice about gaming philosophy, leading to an explosive confrontation.

Local gaming shop
10

Crash at Miles' Party

In a drunken state, Scott crashes Miles' party, where he engages in erratic behavior, including exaggerated stories and mischief. This reckless outing culminates in a physical clash with Miles, highlighting Scott's internal chaos.

Miles' party
11

Wayne's Intervention

Feeling sidelined after the party, Wayne lashes out at Miles, leading to an unexpected fight. This scuffle reveals the complexities of their friendships and Wayne's personal insecurities, adding to the emotional turmoil felt by Scott.

Outside Miles' party
12

New Beginnings

Months pass, and Scott secures a job at his grandmother's new retirement community in Arizona, sharing a living space with Bob and Barbara. This change marks a turning point in Scott's life, as he embraces new responsibilities while continuing his love for gaming.

Arizona retirement community
13

Transformation

Scott's character evolves significantly; he is happier and takes pride in playing games with senior citizens. Despite the positive changes, remnants of his competitive nature persist, illustrating that personal growth is a continuous journey.

14

Final Reflections

The film concludes with a glimpse of Scott enjoying game nights in a new setting, reflecting his adaptation and growth. His experiences underscore the importance of connections, acceptance, and the finding of joy in unexpected places.

Last Updated: November 22, 2024 at 11:12

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cringe Comedies with Heart like Zero Charisma

Movies that find humor in social failure but empathy in the characters.If you liked the blend of awkward humor and character depth in Zero Charisma, explore these movies. They balance cringe comedy with genuine empathy, finding laughs in social misfits while still telling hopeful stories of personal growth and connection.

cringe comedyawkwardpatheticempathetichopefulinsecureresentful

Narrative Summary

The narrative follows a socially inept or deeply insecure protagonist whose actions create a trail of comedic, often painful, awkwardness. The conflict is primarily internal and social, forcing the character to confront their flaws. The journey is not about grand redemption but about small, hard-won steps toward self-awareness and connection.

Why These Movies?

Movies in this thread are grouped by their unique tonal blend. They share a specific kind of humor rooted in second-hand embarrassment, yet they maintain an emotional core that prevents the comedy from becoming cruel, resulting in a bittersweet but ultimately hopeful viewing experience.

Movies about Losing Control of a Niche World like Zero Charisma

Stories about characters whose entire identity is tied to a small, controlled domain.Fans of Zero Charisma will appreciate these stories about characters whose identity is built around a small domain. When a rival threatens their authority, they must confront their insecurities in tales of rivalry, arrested development, and the dynamics of found families.

competitivefrustratedinsecureterritorialresentfulpatheticeventually hopeful

Narrative Summary

The plot revolves around a territorial conflict within a microcosm. The protagonist's rigid worldview and authority are challenged by a new, often more charismatic, presence. This external threat exposes the protagonist's deep-seated insecurities, leading to a crisis that forces them to either adapt or face total collapse within their small but vital world.

Why These Movies?

These films share a core narrative pattern: a protagonist whose identity is inextricably linked to a niche domain faces a challenge to their rule. The focus is on the psychological and social dynamics of this power struggle, exploring themes of insecurity, rivalry, and the painful process of personal change.

Unlock the Full Story of Zero Charisma

Don't stop at just watching — explore Zero Charisma in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what Zero Charisma is all about. Plus, discover what's next after the movie.

Zero Charisma Summary

Read a complete plot summary of Zero Charisma, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Zero Charisma Summary

Characters, Settings & Themes in Zero Charisma

Discover the characters, locations, and core themes that shape Zero Charisma. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Zero Charisma

Zero Charisma Spoiler-Free Summary

Get a quick, spoiler-free overview of Zero Charisma that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Zero Charisma Spoiler-Free Summary

More About Zero Charisma

Visit What's After the Movie to explore more about Zero Charisma: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About Zero Charisma

Similar Movies to Zero Charisma

Discover movies like Zero Charisma that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.