Zero Charisma

Zero Charisma

Year: 2013

Runtime: 86 min

Language: English

Directors: Andrew Matthews, Katie Graham

Comedy

A self-proclaimed grand master of a fantasy board game faces a challenge when a charismatic newcomer threatens his authority. As the stakes rise, the eccentric group descends into chaos, forcing the beleaguered leader to confront his own insecurities and find a way to adapt and maintain control. He must navigate the escalating conflict and the dynamics of the group to survive.

Zero Charisma (2013) – Spoiler-Free Movie Summary & Plot Overview

Get a spoiler-free look at Zero Charisma (2013) with a clear plot overview that covers the setting, main characters, and story premise—without revealing key twists or the ending. Perfect for deciding if this film is your next watch.

In a modest Midwestern town, Scott Weidemeyer spends his evenings orchestrating a ritual that has become his sanctuary: a tightly run tabletop role‑playing game that he treats like a mini‑kingdom, complete with rules, hierarchy, and an iron‑clad grip on the narrative. By day he hauls packages as a delivery driver, but by night he transforms his living room into a battlefield of imagination, where the only thing he can truly control is the dice‑rolling destiny of his friends. The tone of the film balances wry humor with a quiet melancholy, portraying a world where the clatter of dice and the glow of a lamp become the only sounds that matter.

The core of this makeshift realm is a circle of loyal companions, most notably Wayne, the long‑time sidekick who has learned to navigate Scott’s exacting expectations with a blend of deference and dry wit. Their routine is shaken, however, when a charismatic newcomer, Miles, slides into the group, bringing a relaxed confidence and an effortlessly cool demeanor that instantly captivates the other players. Miles’s presence introduces an undercurrent of rivalry, forcing Scott to confront the uneasy truth that his authority may be more fragile than the meticulously crafted rulebook he clings to. The dynamic crackles with both comic tension and genuine reflection, hinting at deeper questions about leadership, ego, and the desire to be valued beyond the game table.

Outside the gaming circle, Scott’s personal life teeters on the edge of upheaval. His grandmother, Wanda, suffers a stroke, prompting the return of his estranged mother, Barbara, and her new partner, Bob, whose arrival threatens to upend the fragile equilibrium Scott has built at home. These familial pressures sit uneasily alongside his obsessive need for control, suggesting that the real battle may lie not in the fantasy realm he masters but in the messy, unpredictable world he has long tried to keep at arm’s length. The film invites viewers to wonder whether Scott can adapt, let go of his self‑imposed grandmaster title, and find a new kind of balance before his carefully constructed kingdom collapses.

Last Updated: August 10, 2025 at 06:09

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cringe Comedies with Heart like Zero Charisma

Movies that find humor in social failure but empathy in the characters.If you liked the blend of awkward humor and character depth in Zero Charisma, explore these movies. They balance cringe comedy with genuine empathy, finding laughs in social misfits while still telling hopeful stories of personal growth and connection.

cringe comedyawkwardpatheticempathetichopefulinsecureresentful

Narrative Summary

The narrative follows a socially inept or deeply insecure protagonist whose actions create a trail of comedic, often painful, awkwardness. The conflict is primarily internal and social, forcing the character to confront their flaws. The journey is not about grand redemption but about small, hard-won steps toward self-awareness and connection.

Why These Movies?

Movies in this thread are grouped by their unique tonal blend. They share a specific kind of humor rooted in second-hand embarrassment, yet they maintain an emotional core that prevents the comedy from becoming cruel, resulting in a bittersweet but ultimately hopeful viewing experience.

Movies about Losing Control of a Niche World like Zero Charisma

Stories about characters whose entire identity is tied to a small, controlled domain.Fans of Zero Charisma will appreciate these stories about characters whose identity is built around a small domain. When a rival threatens their authority, they must confront their insecurities in tales of rivalry, arrested development, and the dynamics of found families.

competitivefrustratedinsecureterritorialresentfulpatheticeventually hopeful

Narrative Summary

The plot revolves around a territorial conflict within a microcosm. The protagonist's rigid worldview and authority are challenged by a new, often more charismatic, presence. This external threat exposes the protagonist's deep-seated insecurities, leading to a crisis that forces them to either adapt or face total collapse within their small but vital world.

Why These Movies?

These films share a core narrative pattern: a protagonist whose identity is inextricably linked to a niche domain faces a challenge to their rule. The focus is on the psychological and social dynamics of this power struggle, exploring themes of insecurity, rivalry, and the painful process of personal change.

Unlock the Full Story of Zero Charisma

Don't stop at just watching — explore Zero Charisma in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what Zero Charisma is all about. Plus, discover what's next after the movie.

Zero Charisma Summary

Read a complete plot summary of Zero Charisma, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Zero Charisma Summary

Zero Charisma Timeline

Track the full timeline of Zero Charisma with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

Zero Charisma Timeline

Characters, Settings & Themes in Zero Charisma

Discover the characters, locations, and core themes that shape Zero Charisma. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Zero Charisma

More About Zero Charisma

Visit What's After the Movie to explore more about Zero Charisma: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About Zero Charisma

Similar Movies to Zero Charisma

Discover movies like Zero Charisma that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.