Zero Charisma

Year: 2013

Runtime: 86 min

Language: English

Directors: Andrew Matthews, Katie Graham

Comedy

A self-proclaimed grand master of a fantasy board game faces a challenge when a charismatic newcomer threatens his authority. As the stakes rise, the eccentric group descends into chaos, forcing the beleaguered leader to confront his own insecurities and find a way to adapt and maintain control. He must navigate the escalating conflict and the dynamics of the group to survive.

Warning: spoilers below!

Haven’t seen Zero Charisma yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline & Setting – Zero Charisma (2013)

Explore the full timeline and setting of Zero Charisma (2013). Follow every major event in chronological order and see how the environment shapes the story, characters, and dramatic tension.

Last Updated: October 22, 2024 at 22:25

Main Characters – Zero Charisma (2013)

Meet the key characters of Zero Charisma (2013), with detailed profiles, motivations, and roles in the plot. Understand their emotional journeys and what they reveal about the film’s deeper themes.

Last Updated: October 22, 2024 at 22:25

Major Themes – Zero Charisma (2013)

Explore the central themes of Zero Charisma (2013), from psychological, social, and emotional dimensions to philosophical messages. Understand what the film is really saying beneath the surface.

Last Updated: October 22, 2024 at 22:25

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cringe Comedies with Heart like Zero Charisma

Movies that find humor in social failure but empathy in the characters.If you liked the blend of awkward humor and character depth in Zero Charisma, explore these movies. They balance cringe comedy with genuine empathy, finding laughs in social misfits while still telling hopeful stories of personal growth and connection.

cringe comedyawkwardpatheticempathetichopefulinsecureresentful

Narrative Summary

The narrative follows a socially inept or deeply insecure protagonist whose actions create a trail of comedic, often painful, awkwardness. The conflict is primarily internal and social, forcing the character to confront their flaws. The journey is not about grand redemption but about small, hard-won steps toward self-awareness and connection.

Why These Movies?

Movies in this thread are grouped by their unique tonal blend. They share a specific kind of humor rooted in second-hand embarrassment, yet they maintain an emotional core that prevents the comedy from becoming cruel, resulting in a bittersweet but ultimately hopeful viewing experience.

Movies about Losing Control of a Niche World like Zero Charisma

Stories about characters whose entire identity is tied to a small, controlled domain.Fans of Zero Charisma will appreciate these stories about characters whose identity is built around a small domain. When a rival threatens their authority, they must confront their insecurities in tales of rivalry, arrested development, and the dynamics of found families.

competitivefrustratedinsecureterritorialresentfulpatheticeventually hopeful

Narrative Summary

The plot revolves around a territorial conflict within a microcosm. The protagonist's rigid worldview and authority are challenged by a new, often more charismatic, presence. This external threat exposes the protagonist's deep-seated insecurities, leading to a crisis that forces them to either adapt or face total collapse within their small but vital world.

Why These Movies?

These films share a core narrative pattern: a protagonist whose identity is inextricably linked to a niche domain faces a challenge to their rule. The focus is on the psychological and social dynamics of this power struggle, exploring themes of insecurity, rivalry, and the painful process of personal change.

Unlock the Full Story of Zero Charisma

Don't stop at just watching — explore Zero Charisma in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what Zero Charisma is all about. Plus, discover what's next after the movie.

Zero Charisma Summary

Read a complete plot summary of Zero Charisma, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Zero Charisma Timeline

Track the full timeline of Zero Charisma with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

Zero Charisma Spoiler-Free Summary

Get a quick, spoiler-free overview of Zero Charisma that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

More About Zero Charisma

Visit What's After the Movie to explore more about Zero Charisma: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

Similar Movies to Zero Charisma

Discover movies like Zero Charisma that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.