Zero Charisma

Zero Charisma

Year: 2013

Runtime: 86 min

Language: English

Directors: Andrew Matthews, Katie Graham

Comedy

A self-proclaimed grand master of a fantasy board game faces a challenge when a charismatic newcomer threatens his authority. As the stakes rise, the eccentric group descends into chaos, forcing the beleaguered leader to confront his own insecurities and find a way to adapt and maintain control. He must navigate the escalating conflict and the dynamics of the group to survive.

Warning: spoilers below!

Haven’t seen Zero Charisma yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Zero Charisma (2013) – Full Plot Summary & Ending Explained

Read the complete plot breakdown of Zero Charisma (2013), including all key story events, major twists, and the ending explained in detail. Discover what really happened—and what it all means.

In the life of Scott Weidemeyer (Sam Eidson), a gruff delivery driver ensnared in a cycle of dissatisfaction, his only refuge emerges during his weekly tabletop game nights. These evenings are meticulously organized by Scott, who reigns over his gaming realm with an iron grip. Among his circle of friends is Wayne (Brock England), Scott’s most trustworthy accomplice, who has adapted to this peculiar ritual of camaraderie. However, when a player suddenly leaves the game to focus on mending his marriage, Scott finds himself grappling with the challenge of finding a worthy substitute.

As Scott ventures through the tumultuous terrain of game night replacements, he encounters Miles (Garrett Graham), a laid-back hipster who epitomizes coolness. Despite his initial hesitations, Miles quickly integrates into the group, winning over Scott’s friends with his amiable and accepting nature. Yet, Scott remains defensive, his jealousy regarding Miles’ enviable lifestyle—boasting a beautiful girlfriend and a successful popular culture website—brewing beneath the surface.

The delicate balance is thrown into chaos when Scott’s grandmother, Wanda (Anne Gee Byrd), suffers a stroke, triggering an unwelcome visit from his mother, Barbara (Cyndi Williams), along with her latest partner, Bob (Larry Jack Dotson). Scott’s bitterness towards Barbara is palpable, stemming from the deep-seated resentment of her abandonment during his childhood when she chose to chase a life in a commune.

As the next game night looms closer, Scott’s pent-up insecurities and frustrations simmer dangerously beneath the surface. His attempts to assert his authority are thwarted when Barbara disrupts the gathering, humiliating Scott in front of his friends and forcing an early conclusion to the evening. This leads the group to choose Miles’ home for their next game night, further stoking Scott’s irritations.

Desperate to reclaim his dominance, Scott boasts of having been the author of The Matrix in junior high, a claim that Miles swiftly dismantles. As tensions escalate, Scott loses control, culminating in a dramatic meltdown as he seeks to cheat during the game. Yet, his friends, no longer willing to indulge his whims, opt to continue their play with Miles, leaving Scott simmering with anger and resentment.

Upon returning to his grandmother’s humble home, Scott receives heartbreaking news—his mother plans to sell Wanda’s cherished residence to satisfy her growing debts. After much persuasion, Wanda is convinced to part with her home in exchange for a comfortable retirement in Arizona. However, Scott’s fury intensifies when he realizes that he will not inherit the property as promised. In a fit of rage, he lashes out at Wanda, forcing her to stand her ground against his disrespect.

Yearning for reassurance, Scott visits the local gaming shop where his idol, Greg Goran (Dakin Matthews), is appearing. Humble yet hopeful, he requests his old job back from Pete ([John Gholson]), the assistant manager. However, the encounter spirals when Scott seeks Greg’s advice on navigating the complexities of role-playing. The wise words of the seasoned gamer—that the game master’s primary role is to prioritize the players’ enjoyment—only serve to further infuriate Scott. In a rage, he berates Greg, insults Pete, and dismisses the store before storming out.

As he battles with his self-pity, Scott misdirects his frustrations towards Miles, blaming him for all his current misfortunes. Intoxicated, he crashes a party hosted by Miles, where he shares outrageous anecdotes with friends and engages in nonsensical, crutch-based sword fights. Despite Miles’ initial hesitance, the two ultimately clash, ending with Scott suffering a gut punch from his friend.

In the aftermath, Wayne, feeling hurt and upset by being left out of the party, intervenes for Scott, leading to an unexpected scuffle where Wayne attacks Miles, only for Miles to retaliate. The two are soon sent packing. During the car ride home, Wayne confesses that he belittled Scott because he needed someone to feel inferior to himself.

Fast forward a few months, and Scott has landed a job at the Arizona retirement community where his grandmother now lives. He shares living arrangements with Bob and Barbara, whose relationship is on shaky ground. Despite this, Scott has transformed—he’s visibly happier, takes on more responsibilities, and now enjoys playing games with a group of senior citizens. In those closing moments of the film, we catch a glimpse of Scott’s newfound positivity, though it remains evident that his competitive spirit is very much alive.

Last Updated: November 22, 2024 at 11:12

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cringe Comedies with Heart like Zero Charisma

Movies that find humor in social failure but empathy in the characters.If you liked the blend of awkward humor and character depth in Zero Charisma, explore these movies. They balance cringe comedy with genuine empathy, finding laughs in social misfits while still telling hopeful stories of personal growth and connection.

cringe comedyawkwardpatheticempathetichopefulinsecureresentful

Narrative Summary

The narrative follows a socially inept or deeply insecure protagonist whose actions create a trail of comedic, often painful, awkwardness. The conflict is primarily internal and social, forcing the character to confront their flaws. The journey is not about grand redemption but about small, hard-won steps toward self-awareness and connection.

Why These Movies?

Movies in this thread are grouped by their unique tonal blend. They share a specific kind of humor rooted in second-hand embarrassment, yet they maintain an emotional core that prevents the comedy from becoming cruel, resulting in a bittersweet but ultimately hopeful viewing experience.

Movies about Losing Control of a Niche World like Zero Charisma

Stories about characters whose entire identity is tied to a small, controlled domain.Fans of Zero Charisma will appreciate these stories about characters whose identity is built around a small domain. When a rival threatens their authority, they must confront their insecurities in tales of rivalry, arrested development, and the dynamics of found families.

competitivefrustratedinsecureterritorialresentfulpatheticeventually hopeful

Narrative Summary

The plot revolves around a territorial conflict within a microcosm. The protagonist's rigid worldview and authority are challenged by a new, often more charismatic, presence. This external threat exposes the protagonist's deep-seated insecurities, leading to a crisis that forces them to either adapt or face total collapse within their small but vital world.

Why These Movies?

These films share a core narrative pattern: a protagonist whose identity is inextricably linked to a niche domain faces a challenge to their rule. The focus is on the psychological and social dynamics of this power struggle, exploring themes of insecurity, rivalry, and the painful process of personal change.

Unlock the Full Story of Zero Charisma

Don't stop at just watching — explore Zero Charisma in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what Zero Charisma is all about. Plus, discover what's next after the movie.

Zero Charisma Timeline

Track the full timeline of Zero Charisma with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

Zero Charisma Timeline

Characters, Settings & Themes in Zero Charisma

Discover the characters, locations, and core themes that shape Zero Charisma. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Zero Charisma

Zero Charisma Spoiler-Free Summary

Get a quick, spoiler-free overview of Zero Charisma that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Zero Charisma Spoiler-Free Summary

More About Zero Charisma

Visit What's After the Movie to explore more about Zero Charisma: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About Zero Charisma

Similar Movies to Zero Charisma

Discover movies like Zero Charisma that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.