Rama Rama Krishna Krishna

Rama Rama Krishna Krishna

Year: 2010

Runtime: 161 mins

Language: Telugu

Director: Sriwass

Drama

Rama Rama Krishna Krishna is a 2010 Telugu film starring Ram, Priya Anand and Bindu Madhavi, with Arjun Sarja, Nassar, Brahmanandam and Gracy Singh in supporting roles. Directed by Srivas (known for Lakshyam) and produced by Dil Raju, it premiered on 12 May 2010. The movie was later dubbed into Tamil as Gandhipuram, released on 24 December 2010.

Where to Watch Rama Rama Krishna Krishna?

Find where to stream, rent, or buy Rama Rama Krishna Krishna (2010) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Streaming availability powered by JustWatch

Warning: spoilers below!

Haven’t seen Rama Rama Krishna Krishna yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Rama Rama Krishna Krishna (2010)

Trace every key event in Rama Rama Krishna Krishna (2010) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Start of the mafia war in Mumbai

Ashok Deva and Pawar wage an endless war across Mumbai, pulling in their networks and leaving a trail of violence. The conflict destabilizes families around them and shapes Deva's choices from the start. The stakes are personal as the city becomes a battleground for power.

Opening phase Mumbai
2

Gauthami's birthday tragedy and vow

Gauthami is killed by Pawar and his group on her birthday, a brutal blow that shatters Deva's world. Before dying, she bids Deva to quit the violence and seek a peaceful life away from mafia. Her death becomes a turning point that steels Deva's resolve to leave the life of crime behind.

Gauthami's birthday Mumbai
3

Exile to Gandhipuram

Deva, his sisters Sirisha and Priya, and their right-hand man Shiva flee Mumbai for Gandhipuram in East Godavari to start anew. They hope distance from Pawar will allow a peaceful life. Pawar presumes Deva is dead, creating a false sense of security for the moment.

After the birthday Gandhipuram, East Godavari district
4

Chakrapani's leadership and Ramakrishna's reputation

In Gandhipuram, Chakrapani is the village head while Ramakrishna becomes known for bashing villains and upholding his father's principles. The villagers look to him as a local guardian and enforcer of order. This dynamic sets the stage for the village's conflict with the mafia.

Upon settling in Gandhipuram Gandhipuram
5

Nandu chases Ramakrishna

A woman named Nandu pursues Ramakrishna, signaling unrest and personal risk in the village. Ramakrishna responds with intensity and loyalty, reinforcing his protective role. The pursuit adds a personal dimension to the otherwise social dispute.

Early in Gandhipuram days Gandhipuram
6

Anand and Sirisha elope to Mumbai

Anand, a medico, and Sirisha (Deva's sister) elope to Subba Rao’s residence in Mumbai because their families won't approve their marriage. The elopement triggers pursuit and entanglements that ripple across both cities. The cross-city movement widens the conflict's scope.

Elopement to Subba Rao's residence Mumbai
7

Ramakrishna, Priya, and Shiva in Mumbai

Ramakrishna, Priya, and Shiva travel to Mumbai to locate the eloped couple. Pawar's men target Shiva and Priya, but Ramakrishna intervenes and saves them from danger. The Mumbai mission deepens Ramakrishna's involvement and personal risk.

Mumbai search operation Mumbai
8

Deva's flashback reveals the past

During the crisis, Ramakrishna learns about Deva's flashback, linking the past to the present conflict. This revelation strengthens his resolve to shield the family and resist Pawar's influence. The backstory explains motives and loyalties that shape the present choices.

Following the Mumbai crisis
9

Ramakrishna orchestrates marriages and returns to Gandhipuram

Ramakrishna takes on the responsibility of arranging Anand's marriage to Sirisha and brings them back to Gandhipuram. The journey is perilous as the mafia continues to pursue them. His actions cement his role as the family guardian.

Return to Gandhipuram Gandhipuram
10

Families consent to new marriages

As tensions ease, the families agree to formalize marriages: Ramakrishna with Priya, and Anand with Sirisha. These alliances realign loyalties and strengthen the collective stand against Pawar. The peace plan hinges on these bonds more than on weapons.

Planning phase in Gandhipuram Gandhipuram
11

Pawar resurfaces for the climax

Pawar returns just as the marriages approach, threatening to derail the fragile peace. The mafia's presence signals an impending showdown that will test the newly formed alliances. The town braces for a high-stakes confrontation.

Climax setup Gandhipuram
12

Final confrontation looms

With the families united, the story moves toward a decisive clash with Pawar. The protagonists prepare for a confrontation that will determine their futures and the fate of Gandhipuram. The momentum shifts from negotiation to a charged showdown.

Climax Gandhipuram

Last updated: February 17, 2026 at 19:55

Was this helpful?

Rama Rama Krishna Krishna (2010) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Rama Rama Krishna Krishna (2010) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does Ashok Deva decide to leave the mafia after Gauthami's death?

A.

Gauthami is killed by Pawar's group on her birthday, which shatters Deva emotionally. Before dying, she pleads with him to abandon the violent criminal lifestyle and seek peace. Her death and final wish motivate Deva to walk away from the mafia and start fresh in the village of Gandhipuram with his sisters and loyal associate Shiva.

Earlier scenes show Deva entrenched in endless warfare with Pawar, making his sudden decision to quit more impactful.

ashok devagauthami deathleave mafiapeaceful life
Q2

Why do Anand and Sirisha elope to Mumbai instead of getting married in Gandhipuram?

A.

Anand, a medical student, and Sirisha fall in love, but their families disapprove of their relationship due to existing tensions and social expectations. Fearing their parents won't consent to the marriage, they elope to Subba Rao's residence in Mumbai to wed secretly.

The timeline establishes early tension between the two families over their children's relationship.

anandsirishaelopemumbaimarriage
Q3

Why does Ramakrishna travel to Mumbai to find the eloped couple?

A.

Ramakrishna is the elder son of Chakrapani, the village head, and feels responsible for protecting his family. When Anand elopes with Sirisha, Ramakrishna takes it upon himself to bring them back, accompanied by Priya (Deva's sister) and Shiva. His sense of duty and family loyalty drives him into the dangerous Mumbai underworld.

Ramakrishna is already established as a protector who 'bashes villains' and upholds his family's principles.

ramakrishnamumbaisearchanandsirisha
Q4

How does Pawar discover that Ashok Deva is still alive?

A.

When Ramakrishna, Priya, and Shiva travel to Mumbai to find the eloped couple, Pawar's men target Shiva and Priya. Ramakrishna's intervention reveals that Deva's family is still alive and in the village. This brings the mafia conflict back into the story and exposes their location to Pawar.

The timeline notes that Pawar 'presumes Deva is dead,' creating a false security that is shattered when the Mumbai mission reveals their survival.

pawarashok devaalivemumbaiexposed
Q5

Why does Pawar want to kill Shiva and Priya in Mumbai?

A.

Pawar is the rival mafia boss locked in an endless feud with Ashok Deva. Even after Deva leaves the mafia, Pawar continues to eliminate threats and consolidate power. Targeting Shiva (Deva's loyal right-hand man) and Priya (Deva's sister) weakens Deva's position and removes potential future threats.

The opening establishes Pawar as a relentless antagonist determined to destroy Deva's network.

pawarshivapriyakillmafia
Q6

Why does Ramakrishna agree to marry Priya?

A.

After Ramakrishna saves Shiva and Priya from Pawar's attack in Mumbai, the families in Gandhipuram decide to strengthen their bonds through marriage. Ramakrishna marrying Priya and Anand marrying Sirisha creates unified family ties that can better protect everyone from Pawar's threats. The marriages serve as both a romantic resolution and a strategic alliance.

The families had already been connected through the elopement, and the marriages formalize and solidify that connection.

ramakrishnapriyamarriagealliancefamily
Q7

How do the village storylines connect to the Mumbai mafia conflict?

A.

The two worlds connect through family ties. Ashok Deva brings his sisters Sirisha and Priya to Gandhipuram to escape the Mumbai mafia war. Sirisha marries Anand (the village head's son), linking Deva's family to the village. When Anand and Sirisha elope to Mumbai, Ramakrishna follows, pulling the village conflict back into the mafia's territory. Pawar then targets the families, merging both storylines.

The timeline establishes both locations as interconnected from the start, with the elopement serving as the bridge.

villagemumbaimafiaconnectionconflict
Q8

Why does Pawar return to Gandhipuram for the climax?

A.

After learning that Ashok Deva is alive and that Ramakrishna has interfered with his Mumbai operations, Pawar resurfaces to eliminate the remaining threat. The marriages being planned in Gandhipuram present an opportunity to finish off the unified family. Pawar's return sets up the final showdown between the protagonists and the mafia.

The timeline notes Pawar continues to 'maneuver in the shadows' even after presuming Deva dead.

pawargandhipuramclimaxconfrontationreturn
Q9

Why are both Ramakrishna and Anand getting married at the same time?

A.

The two marriages serve dual purposes: romantic resolution for the couples and strategic alliance against Pawar. Ramakrishna marries Priya while Anand marries Sirisha, uniting the families from Gandhipuram with Deva's family. These bonds create a stronger collective to face the mafia threat.

Earlier tension between families over the relationships sets up this resolution.

ramakrishnapriyaanandsirishamarriage
Q10

What starts the conflict between Ashok Deva and Pawar?

A.

The film establishes that Deva and Pawar wage an endless war across Mumbai, with both leaders pulling in their networks and leaving trails of violence. While the exact origin is not detailed in the summary, the conflict destabilizes families around them and shapes Deva's choices from the start. The rivalry is ongoing and personal, spanning the entire narrative.

The opening phase explicitly describes the 'mafia war in Mumbai' as the foundational conflict.

ashok devapawarmafia warconflictmumbai
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Mafia Relocation Dramas like Rama Rama Krishna Krishna

Couples flee their violent past, seeking peace but finding new dangers.If you enjoyed the tense escape and new life narrative in Rama Rama Krishna Krishna, explore these movies featuring characters fleeing mafia violence. These films often involve elopement, hidden identities, and the constant threat of revenge in new settings.

tenseromanticviolentchasefamilydangerstarting over

Narrative Summary

Stories typically begin with a violent inciting incident, forcing a main character (or couple) to flee their home and take on new identities elsewhere. The central conflict arises when their past catches up, forcing them to defend their new-found peace through a climactic confrontation.

Why These Movies?

These films share a core narrative structure: escape from danger, followed by the threat of that danger resurfacing. They mix tense pacing with romantic elements and explore themes of family protection, making the emotional journey feel both personal and high-stakes.

Telugu Movies with Dual Love Stories like Rama Rama Krishna Krishna

Two intertwined love stories unfold against a backdrop of external threats.Movies like Rama Rama Krishna Krishna often feature two central love stories that develop alongside each other, offering viewers a multifaceted romantic experience set against dramatic, often violent, conflicts that test the strength of these relationships.

romanticfamilialdramatictenseemotionalintertwined

Narrative Summary

These stories typically introduce two main male characters, often brothers or close friends, each pursuing their own romantic interest. The subplots intertwine and face common challenges, usually climaxing in a shared external threat that tests both couples' bonds before reaching a resolution.

Why These Movies?

The grouping emphasizes the narrative structure of balancing dual romantic arcs within a single, cohesive story. The shared external conflict creates parallel stakes for both couples, allowing for richer character dynamics and a more layered exploration of love and loyalty.

Unlock the Full Story of Rama Rama Krishna Krishna

Don't stop at just watching - explore Rama Rama Krishna Krishna in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Rama Rama Krishna Krishna is all about. Plus, discover what's next after the movie.

Rama Rama Krishna Krishna Summary

Read a complete plot summary of Rama Rama Krishna Krishna, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Rama Rama Krishna Krishna Summary

Characters, Settings & Themes in Rama Rama Krishna Krishna

Discover the characters, locations, and core themes that shape Rama Rama Krishna Krishna. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Rama Rama Krishna Krishna

Rama Rama Krishna Krishna Spoiler-Free Summary

Get a quick, spoiler-free overview of Rama Rama Krishna Krishna that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Rama Rama Krishna Krishna Spoiler-Free Summary

More About Rama Rama Krishna Krishna

Visit What's After the Movie to explore more about Rama Rama Krishna Krishna: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Rama Rama Krishna Krishna