Nari Nari Naduma Murari

Nari Nari Naduma Murari

Year: 1990

Runtime: More mins

Language: Telugu

Director: A. Kodandarami Reddy

Family

In this family drama, wealthy and headstrong Sesha Ratnam dominates Nakkabokkalapaadu, and even her husband Janaki Ramaiha fears her. They have two daughters, Shobha and Neeru, and a strained relationship with Janaki’s mother, Anjali Devi. Anjali’s grandson Venkateswara Rao (NBK) hopes to marry one of the sisters to unite the families, but Sesha opposes. Venk promises to win a daughter’s heart, comes to the village, and both sisters fall for him. His persistence eventually convinces Sesha, and the two families are reunited.

Where to Watch Nari Nari Naduma Murari?

Find where to stream, rent, or buy Nari Nari Naduma Murari (1990) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Streaming availability powered by JustWatch

Warning: spoilers below!

Haven’t seen Nari Nari Naduma Murari yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Nari Nari Naduma Murari (1990)

Trace every key event in Nari Nari Naduma Murari (1990) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Opening in Nakkabokkalapaadu: Sesharatnam's vanity and Veerabhadraiah's secret

The film opens in Nakkabokkalapaadu, where Sesharatnam places beauty above all else. She rebukes her henpecked husband Veerabhadraiah for having a second wife, Nagamani. It is revealed that Veerabhadraiah loved Nagamani before, but his mother Janakamma forced him to marry Sesharatnam.

Nakkabokkalapaadu
2

Truth surfaces and the daughters are born

Sesharatnam discovers the complexity of Nagamani's role and retaliates by rebuking her mother-in-law Janakamma and withdrawing from Veerabhadraiah, deepening the rift in the household. The couple eventually has two daughters, Shobha and Neeru.

Nakkabokkalapaadu
3

Veerabhadraiah engineers a union via his nephew Venkanna

To unite the families, Veerabhadraiah promotes his nephew Venkanna as a prospective match for a daughter of Sesharatnam. He believes this arrangement could mend the rift with Nagamani and bring the clan closer.

Veerabhadraiah's residence
4

Venkanna arrives and faces Sesharatnam's scorn

Venkanna arrives in the village, and Sesharatnam immediately vilifies him, challenging him to win the hand of her daughter. This confrontation sets the stage for a clash between tradition and the new suitor.

the family village
5

Venkanna wooes Shobha and Neeru

Venkanna makes bold attempts to woo both Shobha and Neeru through a series of playful skirmishes and teases. Sesharatnam resists, while Veerabhadraiah watches to see whether the plan will succeed.

the family home
6

Appadu blackmails Veerabhadraiah

Appadu blackmails Veerabhadraiah, threatening to reveal a secret that could shake the family. The disclosure adds pressure to the already tense dynamics and tests loyalties.

Veerabhadraiah's household
7

Venkanna defends his honor as Shobha grows fond

As Shobha grows fond of him, Venkanna defends his own honor and integrity. He explains that his conduct is guided by principle, not deception, despite the heated competition around him.

the village
8

Two sisters declare they won't wed without Venkanna

Donnybrooks intensify as Neeru and Shobha reveal their affection for Venkanna and vow they will not marry without him. The sisters' bold declaration heightens the rivalry and complicates the path to a match.

the family home
9

Family secret comes to light: Nagamani's child

A shocking revelation emerges: one of the two sisters is Nagamani's child, not Sesharatnam's. The two were born around the same time; Sesharatnam had twins and lost her own baby, which Veerabhadraiah retrieved from Nagamani.

the household
10

Elders confront Nagamani and Janakamma

The elders travel to Nagamani and Janakamma to uncover the truth behind the rift. Nagamani asserts that motherhood is defined by love and urges them to recognize the reality and accept the daughters' fates.

Nagamani's home
11

Children decide the future of the match

The elders leave the ultimate decision to the young lovers: Shobha and Neeru ask Venkanna to choose between them. The situation leaves Venkanna bewildered as he stands at a crossroads between two families.

the village
12

Divine consultation at Venkateswara temple

Venkanna rushes to the Venkateswara temple for guidance. The Lord reveals that He awaits an answer to the same question He could not resolve for His wives, Sridevi and Bhudevi, placing Venkanna at a moment of spiritual doubt.

Venkateswara temple
13

Venkanna unites with Shobha and Neeru

Shobha and Neeru approach Venkanna, and guided by the divine message, he binds with both sisters. The film closes on a joyous note as Venkanna fuses with the two and restores family harmony.

the family home

Last updated: October 09, 2025 at 14:30

Was this helpful?

Nari Nari Naduma Murari (1990) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Nari Nari Naduma Murari (1990) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does Sesharatnam oppose Venkanna's marriage proposal?

A.

Sesharatnam opposes Venkanna because she is headstrong and views marriage proposals through the lens of her own pride and the family's status. Additionally, she harbors resentment toward Veerabhadraiah's family due to the history with Nagamani, making her resistant to any plan that involves uniting the families through marriage.

Earlier scenes show Sesharatnam rebuking her mother-in-law Janakamma, establishing her antagonistic stance toward Veerabhadraiah's side of the family.

sesharatnamvenkannamarriageoppositionfamily
Q2

What is the family secret about Shobha and Neeru's parentage?

A.

One of the two sisters is not Sesharatnam's biological child. Sesharatnam had twins but lost her own baby. Veerabhadraiah later brought Nagamani's daughter and claimed her as one of the twins, keeping this secret hidden from everyone until the revelation scene.

The opening scenes establish the complicated relationship between Sesharatnam, Veerabhadraiah, and Nagamani, hinting at hidden truths about the family's past.

shobhaneeruparentagetwinsnagamanisecret
Q3

What happens when Venkanna visits the Venkateswara temple?

A.

Venkanna seeks divine guidance at the Venkateswara temple about choosing between Shobha and Neeru. The deity reveals that He Himself faced the same dilemma with His two wives, Sridevi and Bhudevi, and could not resolve it. This divine parallel helps Venkanna accept that he does not have to choose and encourages him to unite with both sisters.

The elders earlier left the decision to the young lovers, placing Venkanna at a crossroads that mirrors the divine dilemma.

venkannatemplevenkateswaradivineguidancechoice
Q4

Why does Venkanna marry both Shobha and Neeru?

A.

After receiving divine guidance at the temple that mirrors his own situation, Venkanna accepts that he cannot choose between the two sisters who both love him equally. The sisters approach him together, and he unites with both, bringing harmony to the family and resolving the love triangle in a unique way.

Both Shobha and Neeru had declared they would not marry without Venkanna, creating a situation where excluding either one would cause pain.

venkannashobhaneerumarriagebothending
Q5

How did Nagamani's daughter become part of Sesharatnam's family?

A.

Veerabhadraiah loved Nagamani before marrying Sesharatnam. When Sesharatnam lost her own twin babies, Veerabhadraiah took Nagamani's daughter (born around the same time) and brought her into the family as one of the twin daughters. This secret was kept hidden until the revelation.

The opening establishes Veerabhadraiah's prior relationship with Nagamani and the pressure from his mother Janakamma to marry Sesharatnam instead.

nagamanidaughterfamilysecretveerabhadraiah
Q6

What is the blackmail subplot involving Appadu?

A.

Appadu blackmails Veerabhadraiah, threatening to reveal a secret that could damage the family's reputation. This subplot adds tension to the family drama and tests loyalties, though the summary does not detail exactly what secret Appadu holds over Veerabhadraiah.

The blackmail occurs after Venkanna arrives and beginswooing the sisters, adding another layer of conflict to the household.

appadublackmailveerabhadraiahsecretthreat
Q7

What does Nagamani say about motherhood during the confrontation?

A.

When the elders confront Nagamani about the truth, she makes a compassionate statement that the woman who shares love with others is the true mother. She urges everyone to recognize and accept the bonds that already exist, encouraging reconciliation rather than further conflict.

This statement comes after the revelation about the twins and represents Nagamani's generous spirit despite years of exclusion.

nagamanimotherhoodloveacceptancetruth
Q8

Why is Sesharatnam estranged from her mother-in-law Janakamma?

A.

Sesharatnam resents Janakamma because Janakamma forced Veerabhadraiah to marry Sesharatnam instead of Nagamani, whom he truly loved. When Sesharatnam discovers this hidden history and the truth about Nagamani's role, she openly rebukes Janakamma and isolates her from the family's life.

The film opening establishes that Janakamma arranged the marriage between Veerabhadraiah and Sesharatnam despite his feelings for Nagamani.

sesharatnamjanakammariftmother-in-lawestrangement
Q9

How does Venkanna win over both Shobha and Neeru?

A.

Venkanna arrives in the village with charm and determination, immediately engaging in playful and sharp exchanges with Sesharatnam while also pursuing both sisters. His persistence, declarations about protecting honor, and genuine conduct gradually draw both Shobha and Neeru to him, leading them to declare they will not marry without him.

Sesharatnam challenges Venkanna to win her daughter's hand, setting up the competition that drives his interactions with both sisters.

venkannashobhaneeruwooingcharmromance
Q10

Why does Veerabhadraiah want Venkanna to marry one of his daughters?

A.

Veerabhadraiah hopes that uniting his family with his nephew Venkanna will strengthen family bonds and mend the rift caused by the past conflict with Nagamani. He sees this marriage as an opportunity to bring the divided families together and secure a united future.

The opening establishes the family rift caused by Veerabhadraiah's complicated relationship history with Nagamani.

veerabhadraiahvenkannaunionmarriagefamily bonds
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Family Reconciliation Stories like Nari Nari Naduma Murari

Heartfelt stories of estranged families overcoming conflict to find unity.If you enjoyed the emotional journey of family healing in Nari Nari Naduma Murari, you'll find similar heartfelt stories here. These movies feature characters overcoming estrangement and conflict to rebuild familial bonds, all leading to hopeful and happy resolutions.

familialemotionaldramaticconfrontationalupliftingtenderhopeful

Narrative Summary

This thread follows a pattern where a central family conflict, often fueled by a strong-willed parent or past grievances, creates a clear divide. An outsider or a determined insider works to bridge the gap, navigating emotional confrontations and secrets, culminating in a joyful reunion that mends the fractured relationships.

Why These Movies?

Movies are grouped here for their shared focus on the emotional arc of family reconciliation. They balance dramatic confrontations with a hopeful, tender tone, creating a satisfying journey from discord to harmony that resonates with viewers seeking uplifting family stories.

Movies where Love Heals Rifts like Nari Nari Naduma Murari

Romantic persistence bridges divides, uniting families and resolving conflicts.Discover movies similar to Nari Nari Naduma Murari where romance is the key to solving bigger problems. These films blend heartfelt love stories with themes of family conflict, featuring persistent suitors who bring people together for a joyful conclusion.

romantichopefulupliftingemotionalfamilialdramaticcharming

Narrative Summary

The narrative pattern involves a love interest entering a situation marked by conflict or division. Their romantic pursuit becomes intertwined with the effort to resolve the larger issue, often involving winning over a skeptical authority figure. The success of the romance directly leads to the resolution of the central conflict.

Why These Movies?

This thread connects movies where romance is not just a subplot but the driving force for positive change. They share a steady pace, medium emotional weight, and a core belief in hope and perseverance, creating a coherent feel-good experience.

Unlock the Full Story of Nari Nari Naduma Murari

Don't stop at just watching - explore Nari Nari Naduma Murari in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Nari Nari Naduma Murari is all about. Plus, discover what's next after the movie.

Nari Nari Naduma Murari Summary

Read a complete plot summary of Nari Nari Naduma Murari, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Nari Nari Naduma Murari Summary

Characters, Settings & Themes in Nari Nari Naduma Murari

Discover the characters, locations, and core themes that shape Nari Nari Naduma Murari. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Nari Nari Naduma Murari

Nari Nari Naduma Murari Spoiler-Free Summary

Get a quick, spoiler-free overview of Nari Nari Naduma Murari that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Nari Nari Naduma Murari Spoiler-Free Summary

More About Nari Nari Naduma Murari

Visit What's After the Movie to explore more about Nari Nari Naduma Murari: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Nari Nari Naduma Murari

Similar Movies to Nari Nari Naduma Murari

Discover movies like Nari Nari Naduma Murari that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.