A Snow Fairy Tale

A Snow Fairy Tale

Year: 1960

Runtime: 68 mins

Language: Russian

Directors: Eldar Shengelaia, Aleksey Sakharov

AdventureFamilyFantasy

On New Year’s Eve, imaginative boy Mitya boasts to his school friends that his painted‑hand toy watch is enchanted—capable of halting every clock in the world, freezing time itself, and even bringing a snowman back to life. His playful claim sparks a whimsical tale of fantasy and wonder.

Warning: spoilers below!

Haven’t seen A Snow Fairy Tale yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – A Snow Fairy Tale (1960)

Trace every key event in A Snow Fairy Tale (1960) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Mitya's boast about a magical clock

On the night before the New Year, Mitya tells his classmates at school that his painted clock can stop all clocks, freeze time, or even bring a snowman to life. The claim is playful and met with disbelief, setting up a wishful idea that feels far-fetched. The moment plants a spark that will soon blur fantasy and reality.

Night before New Year's Eve School
2

The clock animates the snowman

The clock inside the snowman activates and breathes life into the figure. The snowman becomes animated, no longer a mere ornament but a being with a heartbeat of magic. This shocking transformation marks the first crack in the boundary between fantasy and reality.

Immediately after Mitya's boast Snow-covered location
3

Lyolya emerges as a living girl

The animated snowman takes human form, becoming a beautiful girl whom Mitya names Lyolya. She speaks and moves with life, bringing a new presence into Mitya's world. Their unlikely friendship begins to shape the course of events.

Right after Lyolya's appearance Snowy setting where the snowman stood
4

The Old Year learns of the clock

The Old Year, a mysterious and deceitful figure who fears the coming of the New Year, discovers that the clock exists. He senses an opportunity to stop time and prolong his own existence. This knowledge pushes him toward a plan that could upend the season's balance.

Soon after Lyolya's awakening
5

The Old Year decides to claim the clock

Motivated by fear of the New Year, the Old Year resolves to take the clock so he can halt time and secure his own survival. He believes that manipulating time will shield him from his inevitable end. His resolve sets the stage for a direct confrontation with Mitya and Lyolya.

Shortly after deciding
6

Old Year attempts to persuade, but is refused

The Old Year tries to persuade Mitya and Lyolya to surrender the clock, arguing that his plan would protect people by stabilizing time. Mitya and Lyolya resist, recognizing the danger and unpredictability of wielding such power. The rejection solidifies the conflict over who controls time itself.

Soon after the threat is made
7

The box with three magical items is seized

In his bid to seize control, the Old Year grabs a box containing three ordinary items—a coin, a piece of charcoal, and a scrap of paper with a wax seal. These objects are revealed to be imbued with magic, ready to awaken other snow beings. The theft signals a turning point in the pursuit of the clock.

During the confrontation
8

Three new snowmen are brought to life

Using the magical items, the Old Year breathes life into three additional snowmen who become his assistants. They join the hunt for the clock, increasing the danger and complicating the path toward the New Year. The winter landscape grows crowded with animated figures.

After the items are used
9

The hunt for the clock begins in earnest

With renewed force, the Old Year and his snowman entourage search for the magical clock in time before the New Year arrives. The stakes rise as the countdown draws closer. The pursuit unfolds across a world of snow and enchantment as time itself hangs in the balance.

In the days leading to New Year
10

New Year approaches and the stakes escalate

As the New Year nears, the Old Year's plan looms over the world and the power of the clock becomes the key to whether time can be stopped or released. The narrative tightens around the approaching moment when the old cycle could end. The tension builds toward a climactic turn in the tale.

Very close to New Year
11

The looming price of meddling with time

The sequence of events reveals the high price of tampering with time. The Old Year and the living snow beings shape the fate of the approaching year, testing the balance between preservation and renewal. The characters confront the consequences of magical power and the mercy or danger it can unleash.

Right before New Year
12

Climactic build-up as the New Year nears

With the countdown underway, the world braces for the moment when the old cycle might end and the new one begin. The clock remains central to the conflict, and Lyolya's presence hints at hope beyond fear. The film heightens its stakes as the calendar turns toward renewal.

Just before New Year

Last updated: February 24, 2026 at 13:49

Was this helpful?

A Snow Fairy Tale (1960) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the A Snow Fairy Tale (1960) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does the Old Year want to stop time?

A.

The Old Year fears the arrival of the New Year because it represents his own end. He believes that by seizing the magical clock and stopping time, he can extend his own existence and avoid the inevitable transition to the New Year.

old yeartimenew yearfeardeathmagic clock
Q2

How did the snowman become a living girl?

A.

Mitya placed his painted toy clock inside the snowman instead of a heart. When the clock's magical power activated, it breathed life into the snowman, transforming it into a beautiful girl named Lyolya who can speak and move like a human.

Mitya's earlier boast about the clock's power to bring a snowman to life plant the seed for this transformation.

snowmanlyolyamagic clocktransformationalive
Q3

What do the coin, charcoal, and paper do?

A.

The box containing a coin, piece of charcoal, and scrap of paper with a wax seal holds magical properties. The Old Year uses these three ordinary items to bring three additional snowmen to life as his assistants in the hunt for the clock.

magic itemssnowmenold yearenchantment
Q4

Why does the clock actually work if Mitya was just boasting?

A.

The story blurs the line between imagination and reality. Mitya's genuine belief and playful claim somehow activates the clock's magical properties, suggesting that childhood imagination has real power in this whimsical world.

The opening scene establishes Mitya's sincere conviction about the clock's magical abilities.

magic clockimaginationmityabelieffantasy
Q5

What would happen if the Old Year successfully stopped time?

A.

If the Old Year stops time using the clock, the natural cycle of seasons would be disrupted. The New Year would never arrive, and time itself would freeze. While the Old Year would survive, the world would remain trapped in the old year forever.

time stopold yearconsequencesnew year
Q6

Why does Mitya refuse to give the clock to the Old Year?

A.

Mitya and Lyolya recognize that handing over the clock would be dangerous. The Old Year's plan to stop time, while presented as helping people, would actually unravel the natural flow of the season and trap the world in perpetual stagnation.

mityaclockrefuseold yeardanger
Q7

Why does Lyolya help Mitya instead of the Old Year?

A.

Lyolya was brought to life by the clock that Mitya placed in the snowman, creating a bond between them. She chooses to help Mitya because he gave her life and because they share a common goal of protecting the magic from being misused.

lyolyamityabondprotectionsnowman
Q8

How do the snowmen become the Old Year's assistants?

A.

After seizing the magical box, the Old Year uses the coin, charcoal, and paper to breathe life into three more snowmen. These newly awakened snow beings join his search party to locate the magical clock before the New Year arrives.

The box is described as containing magical items imbued with power to awaken other snow beings.

snowmenold yearassistantsmagic itemshunt
Q9

What is at stake as the New Year approaches?

A.

As midnight approaches on New Year's Eve, the Old Year's deadline to seize the clock grows urgent. If he succeeds before the New Year arrives, he can stop time and prolong his existence. If Mitya and Lyolya can protect the clock until the New Year arrives, the natural cycle continues.

new yearcountdownstakesold year deadline
Q10

What does the snowman turning into a girl represent?

A.

The transformation symbolizes the power of childhood imagination made real. Mitya's innocent belief in magic literally brings Lyolya to life, representing the theme that wonder and imagination have transformative power in the story's whimsical world.

The entire film is built on a child's imaginative premise where fantasy becomes reality.

symbolismimaginationsnowmanlyolyatransformationmeaning
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Whimsical Childhood Fantasy Adventures like A Snow Fairy Tale

Magical adventures sparked by a child's imagination and belief.For fans of A Snow Fairy Tale, this list features movies where a child's imagination brings magic to life. Discover films with gentle whimsy, low-stakes fantasy adventures, and a heartwarming sense of childhood wonder, perfect for family viewing.

whimsicalchildlikemagicaldreamlikeplayfulenchantingwondergentle

Narrative Summary

Stories in this thread typically begin with a simple, imaginative premise from a child's perspective—like believing a toy is magical. This belief triggers a real, yet gentle, fantasy adventure, often involving a helper character from the magical world. The conflict is light, focusing on themes of friendship and wonder rather than danger.

Why These Movies?

These movies are grouped by their shared focus on childhood innocence, a whimsical tone, and a low-intensity plot driven by imagination. They create a safe, enchanting viewing experience centered on the magic of belief.

Gentle Magical Object Fantasies like A Snow Fairy Tale

Stories where a simple object holds the key to a charming fantasy world.If you enjoyed the enchanted toy watch in A Snow Fairy Tale, explore more movies where a magical object sparks a delightful adventure. These films feature low-stakes fantasy, a whimsical mood, and focus on themes of friendship and playful wonder.

magical objectwhimsicalfantasticalplayfullow stakescharmingwonderfamily-friendly

Narrative Summary

The narrative pattern involves a protagonist discovering or believing in the power of a specific object, which then becomes the catalyst for a magical event or journey. The conflict is often tied to a simple goal related to the object's magic, resolved through creativity and heart rather than force.

Why These Movies?

These films share the core concept of a magical object driving a gentle, fantastical plot. They are united by a light emotional weight, a steady, character-driven pace, and an overall sense of playful, non-threatening magic.

Unlock the Full Story of A Snow Fairy Tale

Don't stop at just watching - explore A Snow Fairy Tale in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what A Snow Fairy Tale is all about. Plus, discover what's next after the movie.

A Snow Fairy Tale Summary

Read a complete plot summary of A Snow Fairy Tale, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

A Snow Fairy Tale Summary

Characters, Settings & Themes in A Snow Fairy Tale

Discover the characters, locations, and core themes that shape A Snow Fairy Tale. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in A Snow Fairy Tale

A Snow Fairy Tale Spoiler-Free Summary

Get a quick, spoiler-free overview of A Snow Fairy Tale that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

A Snow Fairy Tale Spoiler-Free Summary

More About A Snow Fairy Tale

Visit What's After the Movie to explore more about A Snow Fairy Tale: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About A Snow Fairy Tale