What’s Buzzin’ Buzzard?

What’s Buzzin’ Buzzard?

Year: 1943

Runtime: 8 mins

Language: English

Director: Tex Avery

FamilyComedyAnimation

Two buzzards suffer from acute food shortage and make up for it by cooking each other, or at least trying to.

Warning: spoilers below!

Haven’t seen What’s Buzzin’ Buzzard? yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – What’s Buzzin’ Buzzard? (1943)

Trace every key event in What’s Buzzin’ Buzzard? (1943) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Hunger in the Painted Desert

In the Painted Desert, a hunger-stricken Durante Vulture laments his appetite while his stomach seems to talk back. He and his companion Joe trade taunts and plot their next move as the prospect of food hangs over them. A comical intermission sign hints at the drooling spectacle to come.

Painted Desert
2

The rabbit distraction

The vultures spot a jackrabbit and immediately dive into a noisy quarrel over him, letting the prize slip away. Their rivalry over prey intensifies the chaos and shows how their gluttony drives every decision. The desert setting provides the backdrop for the ensuing mischief.

Painted Desert
3

Joe’s sly sandwich

The Durante Vulture sits beside a rock while Joe quietly crafts a sandwich with his hand, signaling their ongoing scheming. The tension between predator and accomplice escalates as they scheme around food. The moment foreshadows the traps that follow.

Rock by desert
4

Toothache deception

The vulture yelps and asks Joe to inspect his tooth, then fabricates a toothache to keep Joe off balance. He makes a feint to bite Joe’s head, stirring trouble between them. The deception sets the tone for the later cooking gag.

Near the rock
5

Cooking ruse begins

Joe starts salting the vulture’s tail and delivers a head strike with a mallet, escalating their back-and-forth. The vulture pretends to study a cooking book, seemingly unaware that he’s being prepared as the main course. The trap tightens around their appetite-driven antics.

Rock by desert
6

Log cabin trap

Realizing he’s being cooked, the Durante Vulture bolts into a nearby log cabin. Joe lures him back outside by feigning the sight of a beautiful woman, drawing the target into another trap. The chase resumes with renewed desperation.

Log cabin exterior
7

Butter ambush

Outside, Joe knocks the vulture on the head and then mounds him with butter before making his escape. The pursuit shifts into a brisk, slapstick chase as the two rivals collide again. The kitchen-adjacent trickery continues to escalate.

Outside log cabin
8

Rattlesnake ruse—and real danger

The two vultures whirl around a rock until the Durante Vulture pretends to be a rattlesnake, causing Joe to faint. A real rattlesnake then appears, and the pretender ends up fainting himself. The rubbery danger heightens the cartoon chaos.

Rock vicinity
9

Rock-steak deception

The Vulture paints a rock to resemble a steak and calls Joe over to eat it. Joe takes the bait and eats it, while the vulture’s own deception collapses as he breaks his teeth trying to mimic the real thing. The feint ends up serving no one but the joke.

Rock
10

Kitchen trap spectacle

A chaotic sequence unfolds as a broiling pan, a locked oven, and a conveyor belt leading to a meat slicer appear beneath Joe and the vulture. The vulture rides the mechanism, barely avoiding the slicer as Joe pursues him with a pickaxe. The pursuit moves through a dangerous, improvised kitchen maze.

Desert kitchen contraption
11

Decapitation chase and cactus

The vulture pops up from a hole behind Joe and, in a frenzy to decapitate him, chops at a cactus as the chase continues. Exhaustion sets in, but the pursuit stubbornly persists around the rocky outcrop. The battle remains a physical and comic clash of wits.

Desert rock vicinity
12

Meatless Tuesday revelation

The rabbit returns, is captured, and then breaks the duel by pointing to a calendar that proclaims Meatless Tuesday. Realization dawns that their quarrel over a meal was for nothing, triggering a hysterical meltdown between the two rivals. The gag pivots on a seasonal reminder rather than a prize.

Rock area
13

End credits tease

A Patrons Attention title card appears as the announcer signs off, and a final image of a T-bone steak lingers with Auld Lang Syne playing in the background as the cartoon ends. The closing beat leaves the appetite as the punchline of the entire short.

Last Updated: October 09, 2025 at 12:41

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cartoon Chaos like in What’s Buzzin’ Buzzard?

Whimsical animated shorts where escalating slapstick hijinks drive the plot.If you enjoyed the fast-paced antics and silly rivalry in What’s Buzzin’ Buzzard?, you'll love these other animated movies. This list features classic cartoons and family comedies where absurd logic, escalating chases, and non-stop slapstick humor create a whirlwind of lighthearted fun, perfect for viewers seeking similar fast and funny experiences.

slapstickfast-pacedwhimsicalplayfulabsurdchaoticlightheartedcomic

Narrative Summary

Stories in this thread typically involve a simple premise—often a rivalry, chase, or quest—that serves as a framework for a continuous stream of gags. The plot is linear and straightforward, with each event escalating the absurdity and leading directly to the next comedic set piece, often culminating in a self-referential or fourth-wall-breaking joke.

Why These Movies?

Movies are grouped here because they share a core commitment to physical humor, breakneck pacing, and a playful, consequence-free tone. They appeal to viewers looking for pure, undiluted comedic relief and the charming anarchy of classic animation styles.

Silly Rivalry Stories like in What’s Buzzin’ Buzzard?

Comedic duos whose ridiculous conflicts are driven by simple, exaggerated desires.Find more movies similar to What’s Buzzin’ Buzzard? that feature hilarious cartoon rivalries. These animated films and comedies center on duos whose competitive antics, driven by simple goals like hunger or pride, lead to a cascade of tricks and slapstick failures, capturing the same spirit of playful, absurd conflict.

rivalryabsurdtrickeryschemingduosfarcicalhumorousanimal antics

Narrative Summary

The narrative follows a formula of provocation and retaliation. One character's initial action sparks a cycle of one-upmanship, where each attempt to outsmart the other becomes increasingly elaborate and backfires in comical ways. The journey is less about achieving the goal and more about the inventive, foolish methods employed along the way.

Why These Movies?

These movies are connected by their central focus on a two-character comedic rivalry, the absurd lengths they go to for a trivial goal, and the lighthearted, consequence-free resolution of their conflict. They share a specific comic structure and character dynamic.

Unlock the Full Story of What’s Buzzin’ Buzzard?

Don't stop at just watching — explore What’s Buzzin’ Buzzard? in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what What’s Buzzin’ Buzzard? is all about. Plus, discover what's next after the movie.

What’s Buzzin’ Buzzard? Summary

Read a complete plot summary of What’s Buzzin’ Buzzard?, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

What’s Buzzin’ Buzzard? Summary

Characters, Settings & Themes in What’s Buzzin’ Buzzard?

Discover the characters, locations, and core themes that shape What’s Buzzin’ Buzzard?. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in What’s Buzzin’ Buzzard?

What’s Buzzin’ Buzzard? Spoiler-Free Summary

Get a quick, spoiler-free overview of What’s Buzzin’ Buzzard? that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

What’s Buzzin’ Buzzard? Spoiler-Free Summary

More About What’s Buzzin’ Buzzard?

Visit What's After the Movie to explore more about What’s Buzzin’ Buzzard?: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About What’s Buzzin’ Buzzard?

Similar Movies to What’s Buzzin’ Buzzard?

Discover movies like What’s Buzzin’ Buzzard? that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.