Vihtori ja Klaara

Vihtori ja Klaara

Year: 1939

Runtime: 99 mins

Language: Finnish

Director: Teuvo Tulio

Comedy

Vihtori secretly dates Ritva, who is about to marry boxing champion and garage owner Klasu Tullari, son of Vihtori’s friend Tomi. Their tangled affairs involve Klasu’s daughter Vappu and her fiancé Peter von Schaslick, all under the suspicious Klaara, while Vihtori’s lazy son Nisse acts as a Greek‑chorus. Teuvo Tulio’s only comedy.

Warning: spoilers below!

Haven’t seen Vihtori ja Klaara yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Vihtori ja Klaara (1939)

Trace every key event in Vihtori ja Klaara (1939) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Vihtori's wealth vs Klaara's opera dream

Vihtori Vuorenkaiku, a newly rich former working-class man, is enjoying his wealth. Klaara dreams of a life befitting their new status, including visits to the opera. Vihtori remains uninterested in such refinements, creating early tension between them.

Afternoon Home, Helsinki
2

A phone call with Ritva

The following day Vihtori skips the opera and phones Ritva Vuorenrinne, signaling a lighthearted but serious lingering affair. The call reveals an emotional attachment that goes beyond their marriage. Ritva remains a distant but significant presence.

Following day, daytime Vihtori's residence
3

Klaara calls for a cosmetics shop

In a bold move, Klaara phones Vihtori and announces she wants to open a cosmetics shop, signaling her ambition to convert their status into a business venture. Vihtori feels wary about new ventures while Klaara embraces the idea as a step into independence. The plan sows a seed of distrust about money and control.

Same day Home
4

Vappu announces engagement to Petteri

Vappu visits Vihtori's office and proclaims she will marry Petteri, presenting him as a potential son-in-law. Vihtori is skeptical about Petteri and questions his suitability. Klaara, hearing of the news, warms to the idea when she learns Petteri has a prestigious surname.

Day Vihtori's office
5

Petteri's prestige via von

Vihtori doubts Petteri, but Klaara is intrigued by the von prefix in his surname, hoping it signals better prospects for the family. The exchange widens the gap between Vihtori's pragmatic view and Klaara's social ambitions. Their disagreement foreshadows later conflicts.

Evening Home
6

Vihtori's dream of Klaara with a rolling pin

At night Vihtori has a vivid dream in which Klaara chases him through the streets of Helsinki with a rolling pin. The dream exaggerates their marital tension and fear of losing control. The rolling pin becomes a humorous but sharp symbol of domestic strain.

Night Helsinki streets (dream)
7

Next-day jewellery mishap

The next day Vihtori buys an expensive jewellery piece as a nameday gift for Ritva but forgets to pay for it in his hurry. The jewellery ends up in Klaara's hands, who is amused because Ritva shares the same middle name Ritva. The mishap intensifies the tangled web between spouses and lovers.

Day Jewellery shop
8

Public trouble over unpaid jewellery

Vappu and Petteri end up in trouble for speeding on a public road, and Vihtori is hauled to the police station over the unpaid jewellery. The incident heightens the sense of public exposure for the family. Vihtori explains the situation to the jewellery shop manager to try to resolve it.

Evening Public road and police station
9

Clearing the jewellery debt

Vihtori clears the matter with the jewellery shop manager, resolving the unpaid gift misunderstanding. This resolves one knot in the day’s chaos but leaves others unresolved. Klaara learns more about the Ritva connection and grows anxious.

Afternoon Jewellery shop
10

Storming Ritva's apartment

Klaara learns about Vihtori's relationship with Ritva and storms Ritva's apartment, where Petteri and Vihtori hide under a bed. Petteri steps out, prompting Klaara to fear a romance between Ritva and Petteri. Ritva intervenes to calm the situation.

Evening Ritva's apartment
11

Ritva's innocence and cosmetics sale

Ritva convinces Klaara and Vappu that Petteri is innocent and sells her cosmetics store to Klaara as she marries her fiancé Klasu and moves away from Finland. The sale shifts business control within the family. Vihtori had previously bought the cosmetics shop for Ritva and now must buy it back for Klaara.

Soon after confrontation Ritva's store and family home
12

Shop loop and patchwork family

Vihtori, who had initially bought the cosmetics shop for Ritva, ends up buying it again for Klaara after Ritva's departure. Petteri and Ritva decide to teach Vappu a lesson by making Petteri appear indifferent, then quickly reconcile. The couple emerges happier and the family dynamics settle into a new balance.

Later that week Home
13

Hospital dash and a letter arrives

Klaara accidentally drops a large pot on Vihtori's head, sending him to the hospital. He is slow to return home, while Ritva sends a letter and a wedding photograph. Klaara reads the letter and discovers Ritva Vuorenrinne is Vihtori's daughter, a revelation that shakes her understanding of their past.

After accident Hospital and home
14

Klaara's realization and renewed bond

Moved by the revelation, Klaara ponders why Vihtori never told her about Ritva earlier. The newfound knowledge reshapes their relationship and invites a reconsideration of their marriage. The family begins to mend as trust slowly returns.

Post-hospital Home

Last updated: October 07, 2025 at 09:07

Was this helpful?

Vihtori ja Klaara (1939) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Vihtori ja Klaara (1939) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does Klaara storm Ritva's apartment?

A.

Klaara storms Ritva's apartment after learning about the connection between Vihtori and Ritva. When she arrives, she finds Petteri and Vihtori hiding under the bed, and mistakenly believes Petteri is having a romantic affair with Ritva rather than with her daughter Vappu.

Earlier, Klaara noticed that Vihtori was emotionally distant and frequently calling someone, which planted the seed of suspicion.

klaararitvaapartmentconfrontationsuspicion
Q2

What is Ritva's true relationship to Vihtori?

A.

Ritva Vuorenrinne is actually Vihtori's daughter, not his lover as Klaara suspected throughout the film. This revelation comes at the end when Klaara reads Ritva's letter after Vihtori is in the hospital, completely changing Klaara's understanding of their relationship.

Vihtori's phone calls and secret meetings with Ritva were meant to maintain a father-daughter relationship, not an affair.

ritvavihtoridaughterrevelationfamily secret
Q3

How does the jewellery end up with Klaara?

A.

Vihtori buys an expensive jewellery piece as a nameday gift for Ritva but forgets to pay for it in his haste. The jewellery is delivered to Klaara, who is touched thinking her husband remembered Ritva's nameday. She even notes that her own middle name is Ritva.

The rushed phone call and Vihtori's nervous behavior at the jewellery shop hinted at his carelessness.

jewelleryklaaragiftnamedaymistake
Q4

Why does Klaara accept Petteri after learning his surname?

A.

Klaara warms to Petteri as a potential son-in-law when she learns his surname includes the prestigious "von" prefix. This appeals to her social ambitions and desire for the family to appear respectable in their newly elevated status.

Earlier, Klaara insisted on attending the opera and living a life befitting their new wealth, showing her preoccupation with social standing.

klaarapetterivonsurnamesocial status
Q5

How does the cosmetics shop end up owned by Klaara?

A.

Vihtori originally bought the cosmetics shop for Ritva. When Ritva marries Klasu Tullari and moves away from Finland, she sells her store to Klaara. Since Vihtori had already purchased it for Ritva, he ends up buying it again for Klaara, completing a circular ownership loop.

Klaara's earlier phone call about wanting to open a cosmetics shop planted the seed for this eventual outcome.

cosmetics shopklaararitvaownershippurchase
Q6

What causes Vihtori to end up in the hospital?

A.

During one of Klaara's domestic outbursts, she accidentally drops a heavy pot on Vihtori's head, sending him to the hospital. This happens as a comic culmination of the household's turbulent dynamic.

Vihtori's dream of Klaara chasing him with a rolling pin foreshadows the domestic violence theme.

vihtoriklaarahospitalaccidentpot
Q7

Why does learning Ritva is Vihtori's daughter change Klaara's perspective?

A.

Once Klaara reads the letter and discovers Ritva is Vihtori's daughter, she realizes her husband was simply maintaining a relationship with his child, not having an affair. This revelation softens her anger and helps reconcile their marriage.

Klaara's jealousy and suspicion built throughout the film, making the eventual revelation a turning point.

klaararitvadaughterforgivenessreconciliation
Q8

Why does Vihtori hide under the bed in Ritva's apartment?

A.

Vihtori hides under the bed in Ritva's apartment when Klaara storms in, trying to avoid being caught. His presence there creates the misunderstanding that leads Klaara to believe Petteri is involved with Ritva.

Vihtori's secret phone calls and secretive behavior set up this farcical climax.

vihtoriritvahidebedmisunderstanding
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Domestic Farce movies like Vihtori ja Klaara

Hilarious chaos erupts from tangled relationships and hidden secrets at home.If you liked the frantic, laugh-out-loud energy of Vihtori ja Klaara, you'll enjoy these other films. This section features comedies where domestic settings become stages for chaotic misunderstandings and slapstick humor, perfect for viewers seeking fast-paced, playful stories about tangled relationships.

chaoticfarcicalplayfulabsurdsuspensefulwhimsicaldomestic

Narrative Summary

These stories typically revolve around a central secret or misunderstanding that rapidly escalates, forcing characters into increasingly absurd and precarious situations. The plot is propelled by near-misses, close calls, and a constant threat of discovery, leading to a climax where all truths are revealed, usually resulting in reconciliation and a happy ending.

Why These Movies?

They are grouped by their shared commitment to lighthearted, fast-paced humor rooted in domestic life. The core similarity is the narrative structure of a simple deception spiraling into complex, chaotic fun, all while maintaining a playful tone and avoiding heavy emotional stakes.

Playful social satire films similar to Vihtori ja Klaara

Whimsical stories that poke fun at social climbing and upper-class pretensions.Fans of Vihtori ja Klaara will appreciate these movies that share its playful critique of social climbing and upper-class life. Discover similar comedies where whimsical humor and absurd situations are used to explore themes of family relationships, marital problems, and the funny side of trying to keep up appearances.

whimsicalplayfulsatiricalabsurdfarcesocialdomestic

Narrative Summary

The narrative often follows characters from different social strata whose lives become entangled, leading to comedic conflicts based on misunderstandings about wealth, status, or identity. The plot uses these entanglements to highlight the absurdities of social conventions, typically resolving with a heartwarming message that values genuine connection over social standing.

Why These Movies?

These films are grouped by their shared lighthearted approach to social commentary. They prioritize playful whimsy over sharp critique, using character-driven chaos and farcical elements to explore themes of class and marriage without becoming dark or overly dramatic.

Unlock the Full Story of Vihtori ja Klaara

Don't stop at just watching - explore Vihtori ja Klaara in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Vihtori ja Klaara is all about. Plus, discover what's next after the movie.

Vihtori ja Klaara Summary

Read a complete plot summary of Vihtori ja Klaara, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Vihtori ja Klaara Summary

Characters, Settings & Themes in Vihtori ja Klaara

Discover the characters, locations, and core themes that shape Vihtori ja Klaara. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Vihtori ja Klaara

Vihtori ja Klaara Spoiler-Free Summary

Get a quick, spoiler-free overview of Vihtori ja Klaara that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Vihtori ja Klaara Spoiler-Free Summary

More About Vihtori ja Klaara

Visit What's After the Movie to explore more about Vihtori ja Klaara: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Vihtori ja Klaara