The Chant of Jimmie Blacksmith

The Chant of Jimmie Blacksmith

Year: 1978

Runtime: 113 mins

Language: English

Director: Fred Schepisi

HistoryDramaCrime

Based on a true story, it follows a mixed‑heritage Aboriginal man who endures relentless pressure to abandon his culture and conform to white society. As the weight of racism and forced assimilation becomes unbearable, he ultimately erupts in a violent, horrific act of rebellion.

Where to Watch The Chant of Jimmie Blacksmith?

Find where to stream, rent, or buy The Chant of Jimmie Blacksmith (1978) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Warning: spoilers below!

Haven’t seen The Chant of Jimmie Blacksmith yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – The Chant of Jimmie Blacksmith (1978)

Trace every key event in The Chant of Jimmie Blacksmith (1978) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Jimmie is raised by a missionary family

Jimmie Blacksmith, of Aboriginal and white descent, is raised to adulthood by Reverend Neville and his wife Martha. They hope their influence will civilize him and open doors in early 20th century Australia. He grows up under their care, learning to navigate a society that views him through a racial lens.

early 20th century Australia Reverend Neville's parsonage
2

Jimmie leaves foster home to find work; Healey's underpayment

Jimmie leaves his foster home and seeks work with a letter of recommendation. His first employer, Healey, nitpicks his fence-building and shortchanges his pay. Healey even refuses to write a proper reference, preferring to obscure Jimmie’s illiteracy.

early 1910s Healey's property / fence site
3

Farrell uses Jimmie as muscle and covers up a death

Jimmie works for a local constable, Farrell, who uses him to harass other Aboriginal people. He is forced to capture a former friend who is molested and murdered while in custody, and to cover up the death. This shows how systemic brutality and complicity shape Jimmie’s world.

early career Farrell's jurisdiction
4

Stability at the Newby farm but mistreatment persists

Jimmie finds some stability working on the Newby family farm, but they treat him similarly to other employers. The uneasy routine underscores the racism and economic exploitation he endures. He continues to yearn for independence and dignity.

shortly after starting with them Newby farm
5

Jimmie marries Gilda and she gives birth to a white child

Jimmie summons and marries Gilda Marshall, who arrives pregnant. She gives birth to a white child, a public embarrassment that Jimmie initially accepts with pride in parenthood. The birth complicates his social standing and personal life.

shortly after wedding Newby farm / their home
6

Mort and Tabidgi arrive and the pay dispute escalates

Mort, Jimmie's full-brother, and Tabidgi join his fence-building work. The Newbys use their presence as an excuse to deny Jimmie his pay, arguing the extra men were not part of the arrangement. This betrayal deepens Jimmie's sense of injustice.

after their arrival Newby property / fence site
7

Plans to intimidate the Newby women go wrong

Mrs. Newby and a schoolteacher friend urge Gilda to take her baby and leave for a teaching opportunity. Gilda refuses, prompting Jimmie to enlist Tabidgi to intimidate the Newby women with a plan for a ‘scare’ using hatchets. The plan backfires, turning into a deadly rampage.

when they plan the scare Newby household
8

Massacre at the Newby household

The attempted scare spirals into a rampage that kills Mrs. Newby, Miss Graf, and all the Newby daughters except one infant, while the men are away. Jimmie and Mort flee the scene, but Tabidgi stays behind with Gilda and the child before they depart. The event shatters the community and sets off a nationwide manhunt.

immediately after plan Newby household
9

Healey is murdered; Jimmie declares war

Shortly after the massacre, Jimmie murders his former employer Healey, announcing that he has declared war, echoing the Boer War descriptions he has heard. The killings draw nationwide media attention as the press tracks his crime spree. Jimmie and Mort continue to elude capture.

after rampage Healey's property
10

Tabidgi is captured and faces execution

Tabidgi is captured and sentenced to death as an accessory to murder. He testifies that the killings were not planned but occurred on impulse. His plea highlights the chaos surrounding Jimmie’s rampage.

later after the killings court
11

Jimmie and Mort encounter McCready; hostage situation

Jimmie and Mort meet schoolteacher McCready, whom they initially wound but then take hostage to decide their fate. McCready provokes them with sharp comments about white influence on Aboriginal people. His perspective helps sway Jimmie's subsequent choices.

pursuit after Newby events countryside / farm
12

Mort is killed; Jimmie wounded; they seek shelter

Mort is killed by a pursuing group led by Newby men and Dowie Steed, while Jimmie is shot at in a lake. He manages to tend his wounds and hides in a convent, surviving the pursuit. The brothers' bond fractures as violence escalates.

after hostage episode countryside, lake, convent
13

Capture and last rites

Police capture Jimmie; townspeople beat him as they escort him to jail. In the cell, Rev. Neville performs the last rites, while the town watches a hangman’s implied ceremony, foreshadowing an execution to come. The final image centers on Jimmie’s fate within the justice system.

imminent execution jail

Last updated: October 05, 2025 at 12:27

Was this helpful?

The Chant of Jimmie Blacksmith (1978) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the The Chant of Jimmie Blacksmith (1978) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does Jimmie marry Gilda when she arrives pregnant with another man's child?

A.

Jimmie marries Gilda despite her arriving pregnant with a white child because he desperately wants to build a family and belong to white society. The public embarrassment is significant, but Jimmie wholeheartedly embraces fatherhood, seeing it as an opportunity to achieve the domestic stability and respectability that has always been denied to him as an Aboriginal man.

This moment plants the seeds of Jimmie's tragic gullibility - his eagerness to trust white institutions and people despite repeated betrayals.

jimmie blacksmithgildamarriagepregnancyfamilyacceptance
Q2

What triggers the violent massacre at the Newby farm?

A.

The massacre is triggered when Mrs. Newby and Miss Graf try to convince Gilda to leave Jimmie and take her baby for a teaching opportunity elsewhere. Furious at this attempt to destroy his family and seeing his brother and uncle denied pay, Jimmie enlists Tabidgi to stage a 'scare' with hatchets to frighten the women while the men are away. The planned intimidation spirals out of control, resulting in the deaths of Mrs. Newby, Miss Graf, and all the Newby daughters.

newby farmmassacrehatchetviolenceescalationtabidgi
Q3

Why does Jimmie murder Healey after the Newby massacre?

A.

Jimmie murders Healey, his first employer who had shortchanged him, as part of his declaration of war against white society. He explicitly states he is declaring war the way he heard about during the Boer War, viewing his actions as a justified rebellion against the racism and exploitation he has endured throughout his life. The murder transforms his crimes from a personal vendetta into a broader statement of resistance.

This escalates Jimmie's crimes from a desperate reaction to specific injustice into a conscious, politically motivated campaign of violence.

healeymurderdeclaration of warboer warrebellionexploitation
Q4

Why does Tabidgi help Jimmie with the plan to scare the Newby women?

A.

Tabidgi helps Jimmie because he shares his nephew's outrage at the way the Newby family has treated them - denying Jimmie pay for work his brother and uncle had completed. Tabidgi's participation represents family loyalty and a willingness to stand against the humiliation they have suffered. However, Tabidgi is later captured and sentenced to death as an accessory to murder, testifying that the killings were impulses of anger rather than premeditated.

tabidgiunclenephewfamilyloyaltyaccessorymurder
Q5

What is the significance of the newspaper article McCready shows Jimmie?

A.

The newspaper article McCready shows Jimmie covers the widespread media attention his killings have received, making him a notorious fugitive. This confrontation with the reality of his infamy, combined with McCready's manipulation about Mort's soul being damaged by white influence, causes Jimmie to make the crucial decision to abandon his brother. McCready uses the newspaper to exploit Jimmie's spiritual concerns and separate him from Mort.

mcreadynewspapermediafamemanipulationmortsoul
Q6

Why does Jimmie spare McCready after initially wounding him?

A.

Jimmie spares McCready because the schoolteacher provokes him with arguments about white influence corrupting Aboriginal people, particularly suggesting Mort's soul has been damaged by white society. Rather than killing him, Jimmie takes his advice to heart and decides to abandon Mort, effectively choosing a path of self-preservation over brotherly loyalty. McCready's rhetorical manipulation successfully turns Jimmie against his own family.

mcreadyhostagesparingmanipulationmortbrotheradvice
Q7

What happens to Mort after Jimmie abandons him?

A.

After Jimmie abandons him based on McCready's advice, Mort is killed by a pursuing group led by the Newby males and Miss Graf's fiancé, Dowie Steed. Mort's death represents the tragic consequence of Jimmie's decision to trust white authority and abandon his family ties. The brother who accompanied Jimmie throughout his rampage is betrayed and murdered while Jimmie continues to flee alone.

mortdeathnewbysteedpursuitabandonmentbrother
Q8

Why does Jimmie hide in a convent after being shot at the lake?

A.

Jimmie hides in a convent after being shot at a lake and tending his wounds because he has nowhere else to turn. The convent represents the last refuge for a man who has been rejected by every segment of society - white employers, the police, and now even his own family after abandoning Mort. His choice to seek shelter in a religious institution, despite the irony of its connection to the missionary family that raised him, shows his desperation and final exhaustion.

conventwoundshidingdesperationrefugechurch
Q9

Why does Reverend Neville read last rites to Jimmie in his cell?

A.

Rev. Neville reads last rites to Jimmie despite having raised him from childhood because he still views his role as Jimmie's spiritual guardian, even at the moment of execution. This final act underscores the tragic irony of the missionaries' influence - they shaped Jimmie into a man who believed in white society's promises, only for that same society to destroy him. The hanging proceeds despite Jimmie's unique appearance, with the butcher-hangman noting it will likely be like any other execution.

reverend nevillelast ritesexecutioncellhangmancatholicprison
Q10

What drives Jimmie Blacksmith to commit violent rebellion?

A.

Jimmie's violence is driven by the accumulated weight of relentless racism, exploitation, and broken promises throughout his life. From Healey cheating him to Farrell forcing him to participate in covering up a friend's murder, from the Newbys' pay disputes to the attempt to take his family, each betrayal chips away at his humanity. The final trigger is seeing his family mistreated and his wife persuaded to abandon him - pushing him from a desperate man into a violent rebel declaring war.

The timeline shows a clear progression: each employer exploits Jimmie, each system fails him, building inevitably toward his explosive reaction.

jimmie blacksmithrebellionviolenceracismexploitationoppressioncolonialism
Q11

Why does Jimmie work for Constable Farrell as muscle against other Aboriginal people?

A.

Jimmie works for Farrell because he has no choice - it is one of the few employment options available to an Aboriginal man in early 20th century Australia. Farrell exploits Jimmie's position as a mixed-heritage man who can be used against other Aboriginal people, forcing him to capture a former friend who is later molested and murdered in custody. Jimmie is then complicit in covering up the death, an experience that further degrades his sense of humanity and agency.

farrellconstableaboriginalcomplicitymurdercustodyexploitation
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies about systemic oppression and rebellion like The Chant of Jimmie Blacksmith

Stories of marginalized individuals pushed to their breaking point by an unjust system.If you were moved by the grim tragedy of The Chant of Jimmie Blacksmith, this thread gathers films about characters crushed by systemic injustice who ultimately resort to violent revolt. These movies share a heavy emotional weight and a dark, tense atmosphere, exploring similar themes of racism, moral decay, and the high cost of rebellion.

oppressiveangrytensetragicdesperategrimsomberrelentless

Narrative Summary

The narrative pattern involves a protagonist from a marginalized group facing escalating, institutionalized prejudice. The story methodically documents their humiliation and dehumanization, building unbearable tension until the character commits a horrific act of violence that serves as both rebellion and self-destruction, leading to a catastrophic and bleak conclusion.

Why These Movies?

Movies are grouped here for their shared focus on the devastating impact of systemic oppression, their steady pacing that builds to a violent climax, and their unflinchingly dark tone and bleak endings. They create a similarly intense and heavy viewing experience centered on social injustice.

Movies with a steady moral collapse like The Chant of Jimmie Blacksmith

Character-driven stories where steady pressure leads to a catastrophic break from morality.Fans of The Chant of Jimmie Blacksmith's portrayal of a man's systematic breakdown will find similar narratives here. These films focus on a character's gradual moral decay under pressure, resulting in a violent, tragic outcome. They share a steady pacing, high tension, and a deeply somber and heavy mood.

sombertensetragicpsychologicaldesperategrimuneasyheavy

Narrative Summary

The journey is a linear, character-focused descent. The protagonist is initially sympathetic or ordinary, but faced with unrelenting hardship, betrayal, or injustice, their morality slowly erodes. The film carefully charts each step of their dehumanization, culminating in a point of no return where they commit a horrific act, sealing their tragic fate.

Why These Movies?

These films are united by their focus on a specific character arc: the slow-motion tragedy of a moral collapse. They share a steady, deliberate pacing that makes the downfall feel inevitable, a dark and heavy tone, and an intense, psychologically immersive experience for the viewer.

Unlock the Full Story of The Chant of Jimmie Blacksmith

Don't stop at just watching - explore The Chant of Jimmie Blacksmith in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what The Chant of Jimmie Blacksmith is all about. Plus, discover what's next after the movie.

The Chant of Jimmie Blacksmith Summary

Read a complete plot summary of The Chant of Jimmie Blacksmith, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

The Chant of Jimmie Blacksmith Summary

Characters, Settings & Themes in The Chant of Jimmie Blacksmith

Discover the characters, locations, and core themes that shape The Chant of Jimmie Blacksmith. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in The Chant of Jimmie Blacksmith

The Chant of Jimmie Blacksmith Spoiler-Free Summary

Get a quick, spoiler-free overview of The Chant of Jimmie Blacksmith that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

The Chant of Jimmie Blacksmith Spoiler-Free Summary

More About The Chant of Jimmie Blacksmith

Visit What's After the Movie to explore more about The Chant of Jimmie Blacksmith: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About The Chant of Jimmie Blacksmith

Similar Movies to The Chant of Jimmie Blacksmith

Discover movies like The Chant of Jimmie Blacksmith that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.