Night at the Museum: Kahmunrah Rises Again

Night at the Museum: Kahmunrah Rises Again

Year: 2022

Language: English

Director: Matt Danner

Echo Score: 52
AdventureThrillerFantasyHorrorComedyAnimationFamily

As night descends on the American Museum of Natural History, a summer job for high schooler Nick Daley turns into a thrilling adventure. When an ancient tablet’s magic awakens the exhibits, Nick reconnects with familiar friends. However, the villainous Kahmunrah escapes, planning to unleash an Army of the Dead from the Egyptian underworld. Now, Nick must stop the powerful ruler and prevent chaos from engulfing the museum.

Warning: spoilers below!

Haven’t seen Night at the Museum: Kahmunrah Rises Again yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Night at the Museum: Kahmunrah Rises Again (2022) – Full Plot Summary & Ending Explained

Read the complete plot breakdown of Night at the Museum: Kahmunrah Rises Again (2022), including all key story events, major twists, and the ending explained in detail. Discover what really happened—and what it all means.

In an unexpected twist, the cherished exhibits at the American Museum of Natural History send the newest guard into a panic, much to the chagrin of Larry Daley, who is merely passing through. Out of the shadows emerge the ghostly figures of Theodore Roosevelt and Sacagawea, suggesting that Larry’s son, Nick, would be the perfect choice to take over the guard position. After some internal conflict, Larry gives his reluctant approval.

Meanwhile, Nick is wrestling with his own aspirations, hoping to play the role of DJ at his school’s jazz recital to impress his crush, Mia. Though his teacher, Ms. Montefusco, recognizes his potential, Nick is convinced that he’s fallen short, feeling like a musical failure. Larry attempts to bolster Nick’s spirits by explaining that while Nick will be covering for him at home, he’ll also be taking on the responsibilities of guarding the museum in Japan this summer. Though initially doubtful, Nick ultimately agrees after strong encouragement from his father and ex-wife, Erica.

As Nick reconnects with his eclectic gang—comprised of Rexy, Attila, Jedediah, Octavius, Laaa, Dexter the monkey, and Joan of Arc—he finds himself in charge of securing the basement storage room. However, the unsettling atmosphere and ominous relics prompt Nick to barricade the door with a statue and make a swift exit.

Meanwhile, the villainous Kahmunrah, having escaped captivity, seizes the magical tablet that animates the exhibits and plots to dominate the world. A heart-pounding chase breaks out across the museum, but Kahmunrah proves slippery, ultimately escaping with the tablet. Nick and his allies pursue him while Rexy takes on the task of safeguarding the museum.

Once outside, Joan experiences a vision indicating that Kahmunrah is headed to the Museum of Natural Art, where a special exhibition on the Temple of Dendur is taking place. The gang embarks on a chaotic quest through the art museum, where Kahmunrah, now backed by Seth, the God of Chaos, employs his powers to keep them at bay.

They discover a painting that acts as a portal to ancient Egypt and plunge into it. With dawn approaching, they traverse the Nile River, during which Nick begins to despair over his inability to capture Kahmunrah. However, his friends rally around him with encouragement, helping him regain his resolve. Their journey culminates at the Temple of Dendur, where they navigate dangerous traps before facing Kahmunrah and Seth, who intend to utilize the tablet’s power by playing three specific notes to unleash an army of jackals.

As the serene ambiance of the ancient temple erupts into chaos, Nick confronts his deep-rooted insecurities. In a bold and unconventional move, he reverses the sequence of the notes, harnessing the tablet’s energy to disperse the vicious forces of Seth and Kahmunrah, who had been terrorizing the temple with their jackal minions. Victorious as the supernatural threats are vanquished, Nick and his friends make a daring escape just as the sun rises, bathing the scene in its warm glow.

As they dash away from the temple, Nick’s thoughts are drawn to a mysterious poster of the museum that Sacagawea had given him earlier. Realizing its significance, he leads his companions in a hasty retreat back to their world, barely escaping the consequences of the sun’s ascension.

With his self-assurance renewed and doubts relegated to the past, Nick seizes the chance to audition for the jazz recital once again—this time achieving spectacular success. As he basks in the limelight of his accomplishments, he finds a blossoming romance with Mia and embraces his newfound role as the museum’s night guard, a position that fulfills him and gives him a profound sense of belonging.

Last Updated: November 17, 2024 at 22:21

Ending Explained – What Happens at the End of Night at the Museum: Kahmunrah Rises Again?

Still wondering what the ending of Night at the Museum: Kahmunrah Rises Again (2022) really means? Here’s a spoiler-heavy breakdown of the final scene, major twists, and the deeper themes that shape the film’s conclusion.

In the end, Nick and his team manage to stop Kahmunrah from unleashing chaos on the world. They reach the Temple of the Sun where Kahmunrah plans to use his army of the dead and the magical tablet to open portals into ancient Egypt and summon his army into the modern world. Kahmunrah attempts to harness his power by playing a sacred musical chord, which would summon his soldiers from the Underworld through the portals. To prevent this, Nick uses his musical talent and interrupts Kahmunrah’s final performance, stopping him from unleashing the army and causing chaos. Meanwhile, the exhibits, who are being threatened, are saved and returned to the museum via a poster which Sacagawea had given Nick earlier. Kahmunrah and his ally Seth, the god of chaos, are defeated and sent into the void, effectively ending their plans. The museum’s exhibits are safe, and Nick gains confidence in his role as a night guard. The film closes with a lively party in the museum, with Nick acting as the DJ, emphasizing that while the story was playful and silly, it ultimately celebrates heroism, friendship, and finding your own confidence. Overall, the movie wraps up with the heroes triumphing over evil, restoring order, and hinting at possible future adventures with Nick as the new protagonist.

Last Updated: June 25, 2025 at 08:44

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies with Magical Museum Mayhem like Night at the Museum: Kahmunrah Rises Again

Stories where exhibits and artifacts spring to life after hours, creating chaotic adventures.If you loved the chaotic fun of exhibits coming to life in 'Night at the Museum: Kahmunrah Rises Again', you'll enjoy these movies. This collection features similar family-friendly adventures full of magical awakenings, historical figures, and nighttime escapades in museums and other wondrous settings.

whimsicalmagicalchaoticadventurousfamily-friendlynostalgicenergeticplayful

Narrative Summary

The narrative pattern involves a character, often a newcomer or night guard, discovering that a location's contents magically animate after dark. This leads to a night of adventure, chaos, and facing a threat that emerges from within the now-living exhibits, requiring quick thinking and teamwork to save the day.

Why These Movies?

Movies are grouped here for their shared setting of a magically animate museum, their lighthearted and adventurous tone, and their focus on fast-paced, low-stakes action driven by the chaos of the awakened exhibits. They provide a specific, comforting type of fantasy adventure.

Lighthearted Animated Action-Adventures like Night at the Museum: Kahmunrah Rises Again

Fast-paced animated movies that balance exciting action with humor and heart.Fans of the energetic and cheerful action in 'Night at the Museum: Kahmunrah Rises Again' will find more to love here. Discover animated movies that expertly blend fast-paced adventure sequences with a light tone, comedic relief, and feel-good endings for an exciting yet reassuring experience.

action-packedlightheartedhumorousupliftingenergeticfast-pacedfamilyadventure

Narrative Summary

These stories follow a straightforward heroic quest, often involving a young protagonist who must stop a villain's supernatural plan. The journey is packed with action sequences and narrow escapes, but the tension is consistently alleviated by comedic characters and moments, leading to an unambiguous, happy victory.

Why These Movies?

These movies are grouped by their specific blend of a FAST pacing driven by action, a MEDIUM intensity from perilous situations, and a consistently LIGHT tone and emotional weight. This creates a unique viewing experience that is thrilling without being stressful or dark.

Unlock the Full Story of Night at the Museum: Kahmunrah Rises Again

Don't stop at just watching — explore Night at the Museum: Kahmunrah Rises Again in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what Night at the Museum: Kahmunrah Rises Again is all about. Plus, discover what's next after the movie.

Night at the Museum: Kahmunrah Rises Again Timeline

Track the full timeline of Night at the Museum: Kahmunrah Rises Again with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

Night at the Museum: Kahmunrah Rises Again Timeline

Characters, Settings & Themes in Night at the Museum: Kahmunrah Rises Again

Discover the characters, locations, and core themes that shape Night at the Museum: Kahmunrah Rises Again. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Night at the Museum: Kahmunrah Rises Again

Night at the Museum: Kahmunrah Rises Again Ending Explained

What really happened at the end of Night at the Museum: Kahmunrah Rises Again? This detailed ending explained page breaks down final scenes, hidden clues, and alternate interpretations with expert analysis and viewer theories.

Night at the Museum: Kahmunrah Rises Again Ending Explained

Night at the Museum: Kahmunrah Rises Again Spoiler-Free Summary

Get a quick, spoiler-free overview of Night at the Museum: Kahmunrah Rises Again that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Night at the Museum: Kahmunrah Rises Again Spoiler-Free Summary

More About Night at the Museum: Kahmunrah Rises Again

Visit What's After the Movie to explore more about Night at the Museum: Kahmunrah Rises Again: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About Night at the Museum: Kahmunrah Rises Again