Night at the Museum: Kahmunrah Rises Again

Night at the Museum: Kahmunrah Rises Again

JustWatch#27,2058

Year: 2022

Language: English

Director: Matt Danner

Echo Score: 52
AdventureThrillerFantasyHorrorComedyAnimationFamily

As night descends on the American Museum of Natural History, a summer job for high schooler Nick Daley turns into a thrilling adventure. When an ancient tablet’s magic awakens the exhibits, Nick reconnects with familiar friends. However, the villainous Kahmunrah escapes, planning to unleash an Army of the Dead from the Egyptian underworld. Now, Nick must stop the powerful ruler and prevent chaos from engulfing the museum.

Where to Watch Night at the Museum: Kahmunrah Rises Again?

Find where to stream, rent, or buy Night at the Museum: Kahmunrah Rises Again (2022) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Streaming availability powered by JustWatch

Warning: spoilers below!

Haven’t seen Night at the Museum: Kahmunrah Rises Again yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Night at the Museum: Kahmunrah Rises Again (2022)

Trace every key event in Night at the Museum: Kahmunrah Rises Again (2022) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Larry's Disturbance

The story begins with Larry Daley, who is just passing through the American Museum of Natural History, becoming quite alarmed by the unexpected actions of the museum exhibits. His panic is met with disapproval from the ghostly figures of Theodore Roosevelt and Sacagawea, who appear from the shadows, signaling that Larry's son, Nick, should take over the guard position.

American Museum of Natural History
2

Nick's Aspirations

Nick is introduced as he wrestles with his dreams of performing at his school's jazz recital. Despite his teacher, Ms. Montefusco’s encouragement, Nick feels inadequate, believing he has fallen short in his musical endeavors.

3

Father's Encouragement

Larry attempts to bolster Nick's spirits and encourages him to step into the guarding role. He reassures Nick that while he will be covering for him at home, he will also take on exciting responsibilities at the museum in Japan during the summer.

4

Reuniting with Friends

After accepting his father's suggestion, Nick reconnects with his eclectic group of friends, which includes Rexy, Attila, and Joan of Arc. Assigned to secure the basement storage room, Nick soon feels overwhelmed by the eerie atmosphere and decides to barricade the door and make a hasty exit.

Basement Storage Room, Museum
5

Kahmunrah's Escape

During this chaotic period, the villainous Kahmunrah manages to escape from captivity, seizing the magical tablet that animates the museum's exhibits. He plots to take over the world, resulting in a frantic chase around the museum as he skillfully evades capture.

American Museum of Natural History
6

Joan's Vision

Outside the museum, Joan receives a vision that reveals Kahmunrah's intention to head to the Museum of Natural Art, which is featuring a significant exhibition on the Temple of Dendur. This prompts the gang to embark on a frantic pursuit to prevent him from carrying out his plans.

Museum of Natural Art
7

Chasing Through Art

The gang arrives at the Museum of Natural Art, where they confront the challenges posed by Kahmunrah and his ally, Seth, the God of Chaos. The duo uses their powers to thwart Nick and his friends, creating a chaotic scene in the art gallery.

Museum of Natural Art
8

Portal to Egypt

In a surprising turn of events, the group discovers a painting that serves as a portal to ancient Egypt. They dive into the painting, starting a thrilling journey down the Nile River, where Nick grapples with feelings of inadequacy in capturing Kahmunrah.

Nile River, Ancient Egypt
9

Regaining Confidence

As dawn breaks, Nick begins to lose hope in his ability to catch Kahmunrah. However, encouraged by his friends, he manages to regain his confidence, bolstered by their camaraderie and support through this daunting challenge.

Nile River, Ancient Egypt
10

Temple of Dendur Showdown

The decisive confrontation takes place at the Temple of Dendur. Navigating dangerous traps, Nick and his friends face Kahmunrah and Seth, who are determined to use the tablet to summon an army of jackals. The stakes are high as chaos erupts in the temple.

Temple of Dendur, Ancient Egypt
11

Defeating the Villains

In a climactic moment, Nick confronts his insecurities and devises a bold plan to reverse the notes necessary to harness the tablet's power. This surprising move dispels the chaos created by Seth and Kahmunrah's jackal minions, leading to their defeat.

Temple of Dendur, Ancient Egypt
12

Narrow Escape

With the supernatural threats vanquished, Nick and his friends make a daring escape from the temple just as sunrise approaches. The newfound light symbolizes their triumph, marking the end of their harrowing adventure.

Temple of Dendur, Ancient Egypt
13

Discovering the Poster's Significance

In the aftermath of their victory, Nick recalls a mysterious poster of the museum that Sacagawea had given him earlier. Realizing its importance, he rallies his friends for a hasty retreat back to their world, evading the dangers of the rising sun.

14

Nick's Audition

With his confidence restored, Nick decides to audition once more for the jazz recital. This time, he performs with exceptional skill, resonating with both his aspirations and newfound self-belief, leading to a successful outcome.

15

Embracing New Roles

Having found triumph in both his audition and in vanquishing supernatural threats, Nick embraces his role as the museum's night guard. This position brings him fulfillment and a deeper sense of belonging, complemented by a budding romance with his crush, Mia.

American Museum of Natural History

Last updated: November 17, 2024 at 22:21

Was this helpful?

Night at the Museum: Kahmunrah Rises Again (2022) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Night at the Museum: Kahmunrah Rises Again (2022) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why does Nick agree to become the night guard?

A.

Nick initially feels uncertain about taking the job, but Larry convinces him by explaining that he'll be covering for him at home while also getting to work at the museum in Japan during the summer. Nick ultimately agrees after receiving strong encouragement from his father and ex-wife Erica, seeing it as an opportunity to prove himself.

Larry's earlier mention of Nick taking on responsibilities foreshadows his eventual acceptance of the guard position.

nick daleynight guardlarry daleymuseum jobsummer job
Q2

How does Kahmunrah escape and steal the tablet?

A.

Kahmunrah manages to escape from captivity in the museum and seizes the magical tablet that animates the exhibits. During the chaotic chase that follows, Kahmunrah proves slippery and evades capture, escaping with the tablet to carry out his plan to dominate the world.

The earlier tension around Nick securing the basement storage room creates the distraction that allows Kahmunrah to make his move.

kahmunrahtabletescapemuseumsteal
Q3

What are the three notes Kahmunrah plays to summon the jackal army?

A.

Kahmunrah and Seth intend to use the tablet's power by playing three specific notes that would unleash an army of jackals from the Egyptian underworld. These notes are the key to activating the tablet's dark magic at the Temple of Dendur.

The tension builds as the group discovers Kahmunrah is headed to the Temple of Dendur, hinting at the ritual that will take place there.

three notesjackal armytabletsummontemple of dendur
Q4

How does Nick defeat Kahmunrah at the Temple of Dendur?

A.

At the climactic showdown, Nick confronts his deep-rooted insecurities and makes a bold move by reversing the sequence of the three notes. This reversal harnesses the tablet's energy in an unexpected way, dispersing the vicious forces of Seth and Kahmunrah and dispelling their jackal minions, leading to their defeat.

The earlier moment where Nick despairs over catching Kahmunrah sets up his emotional journey toward finding this creative solution.

nickkahmunrahreverse notesdefeattemple of dendur
Q5

What is the significance of the poster Sacagawea gives Nick?

A.

Sacagawea gives Nick a mysterious poster of the museum earlier in the story. After defeating Kahmunrah, Nick recalls this poster and realizes its significance, he uses it to lead his companions in a hasty retreat back to their world, allowing them to escape before the sun fully rises and traps them in ancient Egypt.

The poster appears early in the narrative as an unexplained gift, establishing its later importance for escape.

sacagaweapostermuseumescapeportal
Q6

Why does Nick feel like a musical failure at the beginning?

A.

Nick dreams of playing the role of DJ at his school's jazz recital to impress his crush, Mia. Despite his teacher Ms. Montefusco recognizing his potential, Nick is convinced he's fallen short and feels like a musical failure, lacking confidence in his abilities.

Larry's attempt to bolster Nick's spirits establishes the emotional stakes for Nick's character arc throughout the film.

nickjazzrecitalfailurecrushmia
Q7

Who is Seth and what powers does he have?

A.

Seth is the God of Chaos, who becomes Kahmunrah's ally in the Museum of Natural Art. He employs his powers to keep Nick and his friends at bay during the chaotic confrontation in the art gallery, using his supernatural abilities to thwart their attempts to stop Kahmunrah.

The mention of Kahmunrah heading to the art museum hints at the darker supernatural forces he has aligned himself with.

sethgod of chaoskahmunrahsupernaturalpowers
Q8

How does Nick regain his confidence during the Nile River journey?

A.

While traversing the Nile River as dawn approaches, Nick begins to despair over his inability to capture Kahmunrah. However, his friends rally around him with encouragement and support, helping him regain his resolve and confidence to continue the pursuit.

This moment of doubt directly foreshadows Nick's ultimate triumph, showing his growth from despair to determination.

nickconfidencenile riverfriendsencouragement
Q9

How does the magical tablet work in the movie?

A.

The ancient magical tablet possesses the power to animate the museum's exhibits, bringing them to life each night. Kahmunrah seeks to use its power to dominate the world, and at the Temple of Dendur, he attempts to harness its full potential by playing three specific notes to unleash an army from the underworld.

The tablet's importance is established from the beginning when Kahmunrah first escapes with it, driving the entire plot forward.

tabletmagicanimateexhibitspower
Q10

How does Joan of Arc know where Kahmunrah is going?

A.

Outside the museum, Joan of Arc experiences a vision that reveals Kahmunrah is headed to the Museum of Natural Art, where a special exhibition on the Temple of Dendur is taking place. This vision guides the gang to pursue him to the correct location.

This supernatural vision serves as the critical plot point that propels the story from the natural history museum to the art museum and ultimately to ancient Egypt.

joan of arcvisionkahmunrahmuseum of natural arttemple of dendur
Q11

Does Nick successfully audition for the jazz recital?

A.

Yes. After defeating Kahmunrah and overcoming his insecurities, Nick's self-assurance is renewed. He decides to audition for the jazz recital once again and achieves spectacular success, impressing everyone with his performance and earning a blossoming romance with Mia.

Nick's journey from feeling like a musical failure to gaining confidence directly parallels his character growth in the museum adventure.

nickjazzauditionrecitalsuccessmia
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies with Magical Museum Mayhem like Night at the Museum: Kahmunrah Rises Again

Stories where exhibits and artifacts spring to life after hours, creating chaotic adventures.If you loved the chaotic fun of exhibits coming to life in 'Night at the Museum: Kahmunrah Rises Again', you'll enjoy these movies. This collection features similar family-friendly adventures full of magical awakenings, historical figures, and nighttime escapades in museums and other wondrous settings.

whimsicalmagicalchaoticadventurousfamily-friendlynostalgicenergeticplayful

Narrative Summary

The narrative pattern involves a character, often a newcomer or night guard, discovering that a location's contents magically animate after dark. This leads to a night of adventure, chaos, and facing a threat that emerges from within the now-living exhibits, requiring quick thinking and teamwork to save the day.

Why These Movies?

Movies are grouped here for their shared setting of a magically animate museum, their lighthearted and adventurous tone, and their focus on fast-paced, low-stakes action driven by the chaos of the awakened exhibits. They provide a specific, comforting type of fantasy adventure.

Lighthearted Animated Action-Adventures like Night at the Museum: Kahmunrah Rises Again

Fast-paced animated movies that balance exciting action with humor and heart.Fans of the energetic and cheerful action in 'Night at the Museum: Kahmunrah Rises Again' will find more to love here. Discover animated movies that expertly blend fast-paced adventure sequences with a light tone, comedic relief, and feel-good endings for an exciting yet reassuring experience.

action-packedlightheartedhumorousupliftingenergeticfast-pacedfamilyadventure

Narrative Summary

These stories follow a straightforward heroic quest, often involving a young protagonist who must stop a villain's supernatural plan. The journey is packed with action sequences and narrow escapes, but the tension is consistently alleviated by comedic characters and moments, leading to an unambiguous, happy victory.

Why These Movies?

These movies are grouped by their specific blend of a FAST pacing driven by action, a MEDIUM intensity from perilous situations, and a consistently LIGHT tone and emotional weight. This creates a unique viewing experience that is thrilling without being stressful or dark.

Unlock the Full Story of Night at the Museum: Kahmunrah Rises Again

Don't stop at just watching - explore Night at the Museum: Kahmunrah Rises Again in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Night at the Museum: Kahmunrah Rises Again is all about. Plus, discover what's next after the movie.

Night at the Museum: Kahmunrah Rises Again Summary

Read a complete plot summary of Night at the Museum: Kahmunrah Rises Again, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Night at the Museum: Kahmunrah Rises Again Summary

Characters, Settings & Themes in Night at the Museum: Kahmunrah Rises Again

Discover the characters, locations, and core themes that shape Night at the Museum: Kahmunrah Rises Again. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Night at the Museum: Kahmunrah Rises Again

Night at the Museum: Kahmunrah Rises Again Ending Explained

What really happened at the end of Night at the Museum: Kahmunrah Rises Again? This detailed ending explained page breaks down final scenes, hidden clues, and alternate interpretations with expert analysis and viewer theories.

Night at the Museum: Kahmunrah Rises Again Ending Explained

Night at the Museum: Kahmunrah Rises Again Spoiler-Free Summary

Get a quick, spoiler-free overview of Night at the Museum: Kahmunrah Rises Again that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Night at the Museum: Kahmunrah Rises Again Spoiler-Free Summary

More About Night at the Museum: Kahmunrah Rises Again

Visit What's After the Movie to explore more about Night at the Museum: Kahmunrah Rises Again: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Night at the Museum: Kahmunrah Rises Again