My Mother's Wedding

My Mother's Wedding

JustWatch#6,63323

Year: 2025

Runtime: 1 h 35 m

ComedyDrama

Three sisters, played by Scarlett Johansson, Sienna Miller, and Emily Beecham, reunite at their family home for their mother’s third wedding. Kristin Scott Thomas portrays the twice-widowed mother, and as the weekend progresses, the family celebration becomes a catalyst for revisiting old memories and confronting unresolved issues between mother and daughters. The gathering forces them to examine their shared history and the complexities of their relationships.

Where to Watch My Mother's Wedding?

Find where to stream, rent, or buy My Mother's Wedding (2025) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Warning: spoilers below!

Haven’t seen My Mother's Wedding yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – My Mother's Wedding (2025)

Trace every key event in My Mother's Wedding (2025) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Sisters return to the family home for their mother's wedding

Katherine, Victoria and Georgina travel to the English countryside to attend Diana's wedding to Geoff Loveglove. The gathering reunites them with their family history and unsettled memories of their fathers. The mood blends anticipation with the weight of unresolved past choices.

Before the wedding Family home, English countryside
2

Wedding reception drama: Jerome arrives and Charlie reconnects

During the wedding reception, Victoria's wealthy French lover Jerome arrives by helicopter despite her request. She also rekindles a connection with her childhood sweetheart Charlie. The moment heightens the sisters' romantic tensions and unsettled loyalties.

Wedding day Wedding venue, English countryside
3

Private detective footage reveals infidelity

After the reception, the sisters watch footage from a private detective showing Jeremy having sex with another woman in their house. Georgina feels disgust and fury, realizing the betrayal touches the very family she hoped to protect. The discovery intensifies distrust among the siblings.

After the reception Diana's house
4

Past family names and adoptions discussed

Katherine explains that Jonathan asked to adopt her and Victoria, prompting a debate over whether to change their last names. Victoria confesses she would have taken Jonathan's name, deepening her sense of betrayal. The sisters confront the meaning of identity within their fractured family.

During the post-reception discussion Diana's house
5

Discovery of Victoria's one-night stand with Jeremy

Georgina accuses Victoria of manipulating the detective's investigation as Katherine reveals the truth of Victoria's one-night stand with Jeremy before he met Georgina. The revelation sparks renewed arguments about loyalty and truth.

During the same discussion Diana's house
6

Jack reveals IVF pregnancy and Katherine's conflict

Back at Diana's house, Jack tells Katherine she is pregnant through in vitro fertilisation. Katherine is distressed that Jack made this decision without consulting her and insists she will not sacrifice her naval career or become a co-parent without consent.

Later that evening Diana's house
7

Dawn crisis: Skylar climbs a tree and Victoria is humiliated

At dawn, Geoff calls the fire brigade after Victoria's 14-year-old son Skylar climbs a tree. A firefighter films Victoria, leading to her explosive outburst toward Geoff. Diana responds with a sharp rebuke and slaps Victoria for the chaotic moment.

Dawn Diana's home
8

Confrontations at the graves: fathers revealed

The next morning at their fathers' graves, Diana reveals that their fathers were not and never were perfect, and explains Jonathan's attempt to change their last names. The sisters absorb painful truth and begin to let go of idealized memories.

Next morning John Frost and Jonathan Munson graves
9

Victoria apologizes to Geoff; Georgina moves toward divorce

Victoria apologizes to Geoff and decides to give Charlie another chance. In London, Georgina finds the courage to divorce Jeremy and throw him out of the house. The sisters' personal relationships begin to shift toward healing.

Morning after dawn Geoff's home; Georgina's London home
10

Katherine's promotion ceremony on HMS Prince of Wales

The family attends Katherine's promotion ceremony aboard HMS Prince of Wales, celebrating her achievement as the first woman to command a British aircraft carrier. The milestone brings a sense of pride and renewed commitment to family.

Ceremony day HMS Prince of Wales
11

Katherine reconciles with Jack and welcomes the baby

After the ceremony, Katherine reconciles with Jack and expresses readiness to welcome Jack's baby into their family. She reaffirms her commitment to both her career and Jack, signaling a new balance of love and duty.

After ceremony On board HMS Prince of Wales

Last updated: June 12, 2026 at 08:45

Was this helpful?

My Mother's Wedding (2025) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the My Mother's Wedding (2025) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why did Katherine react so strongly to Jack's pregnancy news?

A.

Katherine was upset because Jack made the decision to get pregnant through IVF without consulting her first. As a Royal Navy captain who has just become the first woman to command a British aircraft carrier, Katherine is deeply committed to her career at sea. She felt excluded from a major life decision and insisted she could not give up her vocation or become a co-parent to a child she never asked for.

Earlier in the film, Katherine's demanding career keeps her away at sea for long stretches, establishing her struggle to balance duty with personal life.

katherinejackpregnancyivfroyal navycareer conflict
Q2

Why did Victoria have a one-night stand with Jeremy before he met Georgina?

A.

The summary doesn't provide a clear motivation for Victoria's one-night stand with Jeremy, but the revelation surfaces during the family confrontation as a bombshell that deepens the sisters' distrust of each other. The discovery enrages Georgina particularly, as it adds another layer of betrayal to Jeremy's infidelity.

The tension between Victoria and Georgina simmers throughout the wedding weekend, with underlying resentments surfacing during arguments.

victoriajeremyaffairgeorginabetrayalone-night stand
Q3

What was Jonathan Munson's connection to Katherine and Victoria?

A.

Jonathan Munson was a man Diana once loved before he disappeared. Years before the events of the film, Jonathan asked to adopt both Katherine and Victoria, wanting to give them his surname. Katherine preferred to keep their birth father John Frost's name, while Victoria confesses she would have taken Jonathan's name, deepening her feeling of betrayal when he vanished.

The sisters' debate about family names surfaces during the post-reception discussion, hinting at unresolved feelings about their fathers.

jonathan munsonadoptionkatherinevictoriasurnamefamily history
Q4

Why did Diana slap Victoria during the tree incident?

A.

Diana slapped Victoria after the chaotic dawn incident where Victoria's fourteen-year-old son Skylar climbed a tree and a firefighter filmed Victoria in a moment of vulnerability. The incident left Diana feeling humiliated, and when Victoria lashed out at Geoff for not understanding what it means to raise children, Diana snapped and slapped her daughter in front of the family.

The tension between Victoria and Geoff escalates throughout the weekend, with Victoria's parenting choices becoming a point of contention.

dianavictoriaslapskylartreefirefighterconfrontation
Q5

Why did Georgina hire a private detective to investigate Jeremy?

A.

At Victoria's suggestion, Georgina hired a private detective to investigate her husband Jeremy for possible infidelity. Georgina hoped to uncover concrete evidence that might free her from the uncertainty she felt about her marriage. However, Georgina later suspects that Victoria's push for evidence was as much about controlling her own narrative as about genuinely helping Georgina.

Victoria's own complicated romantic history and tendency to manipulate situations sets up her involvement in Georgina's marriage troubles.

georginajeremyprivate detectiveinfidelitydivorceinvestigation
Q6

What secret did Katherine reveal about her time in Africa?

A.

During the family argument, Katherine admitted she kissed another woman during a desert assignment in Africa. This previously hidden history was used by Victoria to frame their argument, revealing that even the seemingly straightforward Katherine has kept secrets from her sisters.

Katherine's intense focus on her naval career and personal discipline suggests she has compartmentalized aspects of her life.

katherineafricakisssecretdesertmilitaryhidden past
Q7

Why did Jerome arrive by helicopter at the wedding?

A.

Jerome, Victoria's wealthy and much older French lover, arrived by helicopter at the wedding despite Victoria's warnings to stay away. His dramatic entrance re-enters Victoria's life during the celebration, heightening romantic tensions and creating conflict with Victoria's attempts to move forward.

Victoria's glamorous Hollywood lifestyle and complicated romantic history sets up her entanglement with Jerome.

jeromevictoriahelicopterweddingfrench loverromantic tension
Q8

What did Diana reveal about the sisters' fathers at the graves?

A.

At the graves of John Frost and Jonathan Munson the next morning, Diana confronted the idealized memories of their fathers. She revealed that neither man was perfect and explained Jonathan's attempt to change their last names. This painful truth helped the sisters let go of idealized memories of their fathers and begin to move forward.

The sisters' unresolved feelings about their fathers and family identity have been building throughout the wedding weekend.

dianafathersgravesjohn frostjonathan munsonrevelationfamily truth
Q9

Why did Victoria apologize to Geoff after the wedding?

A.

After the dawn confrontation and Diana's revelation about letting go of the past, Victoria took steps toward healing. She apologized to Geoff for her outburst during the tree incident and decided to give Charlie, her childhood sweetheart, a real chance, signaling her willingness to pursue more genuine connections.

The intense confrontation with Diana forces Victoria to reassess her relationships and patterns.

victoriageoffapologyreconciliationcharliechildhood romance
Q10

Why did Georgina decide to divorce Jeremy after discovering the affair?

A.

After watching video footage from the private detective showing Jeremy in an intimate moment with another woman inside her home, Georgina felt disgust and fury. The discovery of Jeremy's betrayal, combined with the revelation of Victoria's one-night stand with him, gave Georgina the resolve to divorce Jeremy and reclaim her life.

Georgina's role as a palliative nurse who faces death daily gives her clarity about what she wants from life.

georginajeremydivorceinfidelityaffairvideo footagedecision
Q11

What is the significance of Katherine's promotion ceremony on HMS Prince of Wales?

A.

Katherine's promotion ceremony aboard HMS Prince of Wales celebrates her achievement as the first woman to command a British aircraft carrier. The moment represents a public vindication of her hard-won naval career and her commitment to both her duty and her family. After the ceremony, she reconciles with Jack and expresses readiness to welcome their baby, finding a new balance.

Katherine's career ambition and trailblazing role in the Royal Navy has been established throughout the film as her primary identity.

katherinepromotionhms prince of walesroyal navyfirst female commandercareerachievement
Q12

How did the sisters' father John Frost die in the Falklands War?

A.

John Frost, the sisters' father, died in the Falklands War, which explains his status as a英雄 in the family narrative. His death, along with Diana's subsequent marriage to two Navy pilot husbands before Geoff, casts a bittersweet pall over the wedding celebration. The legacy of war and loss shapes the family's history and the daughters' relationships with their mother.

The family's history with Navy pilots and military service runs through Katherine's own career choice.

john frostfalklands warfatherdeathnavymilitarylegacy
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Family Reunion Dramedies like My Mother's Wedding

Where a family gathering forces long-buried secrets and tensions to the surface.Discover movies like My Mother's Wedding where a family gathering brings long-buried tensions and secrets to light. These dramedies blend heartfelt confrontations with moments of humor and hope, perfect for fans of emotional family stories.

family dramatense confrontationscatharticdomestic chaosemotional releasenostalgicreflective

Narrative Summary

Stories in this thread typically unfold over a short, contained timeframe like a weekend gathering. The reunion acts as a pressure cooker, forcing characters to confront past traumas, sibling rivalries, and parental conflicts. The narrative builds through a series of emotional revelations and confrontations, often leading to a cathartic resolution and renewed family bonds.

Why These Movies?

These movies are grouped together because they share a specific narrative structure (the reunion catalyst), a mix of dramatic and comedic tones, and a focus on domestic interpersonal dynamics. They deliver a viewing experience that is emotionally engaging but ultimately hopeful.

Mother-Daughter Relationship Movies like My Mother's Wedding

Exploring the fraught, loving, and complicated bonds between mothers and their adult daughters.If you liked the complex mother-daughter dynamics in My Mother's Wedding, explore these character-driven films. They delve into the fraught, loving, and complicated bonds between mothers and their adult daughters with similar emotional depth.

emotionalconfrontationsreflectivecatharticfamily dramaunresolved traumacoming to terms

Narrative Summary

These narratives focus on the emotional journey of reconciling with a parent's past and one's own inherited legacy. Conflicts arise from clashing perspectives, unresolved childhood issues, and the daughters' struggle to define themselves outside of their mother's shadow. The journey typically involves confronting hard truths to achieve a deeper, more honest understanding.

Why These Movies?

This thread groups movies based on their central thematic focus on mother-daughter relationships and their specific emotional tone. They share a medium intensity, a steady, reflective pacing, and a narrative arc that moves from tension toward a bittersweet yet hopeful resolution.

Unlock the Full Story of My Mother's Wedding

Don't stop at just watching - explore My Mother's Wedding in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what My Mother's Wedding is all about. Plus, discover what's next after the movie.

My Mother's Wedding Summary

Read a complete plot summary of My Mother's Wedding, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

My Mother's Wedding Summary

Characters, Settings & Themes in My Mother's Wedding

Discover the characters, locations, and core themes that shape My Mother's Wedding. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in My Mother's Wedding

My Mother's Wedding Spoiler-Free Summary

Get a quick, spoiler-free overview of My Mother's Wedding that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

My Mother's Wedding Spoiler-Free Summary

More About My Mother's Wedding

Visit What's After the Movie to explore more about My Mother's Wedding: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About My Mother's Wedding