The Bear’s Tale

The Bear’s Tale

Year: 1940

Runtime: 9 mins

Language: English

AnimationFamilyComedy

The Three Bears meets Little Red Riding Hood, told in the style of Tex Avery.

Warning: spoilers below!

Haven’t seen The Bear’s Tale yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

The Bear’s Tale (1940) – Full Plot Summary & Ending Explained

Read the complete plot breakdown of The Bear’s Tale (1940), including all key story events, major twists, and the ending explained in detail. Discover what really happened—and what it all means.

Once upon a time, there was a humorous and creatively reimagined version of the classic children’s story, Goldilocks and the Three Bears. The animated tale begins in a charming little cottage inhabited by Papa Bear, Mama Bear, and Baby Bear. As they sit at the breakfast table, eagerly awaiting their porridge, an unexpected mishap occurs when a bowl of porridge drops onto the table in front of each of them. They quickly deduce that their porridge is too hot to eat and decide to take a leisurely ride through the forest to cool down.

Mama Bear takes a moment to check her appearance in a mirror, turning it to view her reflection from behind, giving viewers a glimpse of her backside. Meanwhile, the family heads for the door—Baby Bear leaves through a small door, Mama Bear through a medium-sized door, and Papa Bear through a large door. We see them riding through the woods on a tricycle; Mama and Papa decide to take a break from pedaling, leaving Baby Bear to continue powering the tricycle out of fear of crashing.

The story then introduces Goldilocks, who is skipping carelessly through the forest and comes upon the Bears’ cottage. She knocks on the door and is about to enter when unexpectedly, the Big Bad Wolf, portrayed in bed dressed in Grandma’s nightgown and cap in a humorous twist, greets her. The wolf’s voice is deep as he says, “Come in Little Red…”, then quickly softens to a female tone, “Come in Little Red Riding Hood!”. When Goldilocks opens the door, the wolf looks surprised and questions her, saying, “What is this, a frame-up? Who are you?”. She introduces herself, asking if this is the home of the Three Bears, to which the wolf sarcastically responds, “Nah, this isn’t where the Three Bears live! That outfit lives two miles down the road at the first stop signal!” Before she can cause trouble, he shoos her out.

Realizing that Goldilocks is the girl from the well-known story, the wolf hurries off to the Bears’ cottage, catching a cab with the command, “To the three Bear’s house, and step on it! I’ll take care of any tickets!” Once inside, he sneaks into the Baby Bear’s bed, waiting for his chance to act.

Meanwhile, as Papa Bear humorously tries to imitate a police siren—only to be laughed at by Mama—the Bears arrive home to find their bowls of porridge empty. Upstairs, the wolf is loudly sneezing in the bed, which raises their suspicion of an intruder. All the Bears quickly hide under the table, trying to stay out of sight. Papa Bear, gathering some courage, declares he will confront the intruder upstairs. Walking into the room, he expects to see Goldilocks, but instead, he finds the wolf and, overwhelmed by fear, runs back downstairs shouting, clutching his family. They all dash out of the house in a comedic chase scene, with the narrator providing a humorous commentary: “So over the hill went the three Bears. Papa Bear, the Mama Bear, and the little ‘bare behind’”. As Baby Bear runs away, his pants slip down, revealing his bare bottom in a funny final touch.

Meanwhile, Little Red Riding Hood, on her way to visit her Grandma with a basket of goodies, notices something strange when she calls out and finds a note pinned to her grandma’s pillow. It reads, “Dear Red: Got tired of waiting. Have gone to Three Bears’ house to eat up Little Goldilocks. Love, the Wolf.” Alarmed, Red quickly picks up the phone to warn Goldilocks of the wolf’s plans. Goldilocks, who is upstairs feeling sleepy from eating too much porridge, is in the process of climbing the stairs when the phone rings. She answers just in time, and then passes the note to Goldilocks, who reads it with a mixture of surprise and gratitude. She thanks Red and ends the call, even checking the coin slot for loose change—a humorous detail emphasizing her absent-mindedness.

As the Bears return home, they discover their empty bowls and anxiously listen for sounds upstairs. Sure enough, they hear the wolf sneeze and realize someone is hiding inside. Panicked, they scramble for cover beneath the table. Papa Bear, trying to be brave, decides to investigate further, climbing the stairs with a determined look. When he finally opens the door to the bedroom, he is stunned to see the wolf instead of Goldilocks. Overcome with fear, he can’t speak and quickly runs downstairs, grabs his family, and they all escape the cottage in a frantic chase. As they leave, the narrator humorously describes their departure: “So over the hill went the three Bears. Papa Bear, the Mama Bear, and the little ‘bare behind’”, and as Baby Bear runs off, his pants slip down once again, revealing his bottom in a comically exaggerated way.

This lively adaptation of the beloved story combines humor, surprise, and playful twists, making it a delightful retelling for viewers of all ages. The characters’ exaggerated antics and the blending of different story elements create a whimsical and entertaining experience, full of memorable moments and comic misadventures.

Last Updated: August 19, 2025 at 05:15

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Cartoon Slapstick Chaos like in The Bear’s Tale

High-energy animated shorts filled with exaggerated gags and frantic chases.If you enjoyed the fast and funny antics of The Bear’s Tale, you'll love these other movies. This section highlights classic animation and modern cartoons that share a similar vibe of exaggerated slapstick, surreal humor, and lighthearted, rapid-fire comedy.

slapstickchaoticzanysillyplayfullightheartedexaggeratedsurreal

Narrative Summary

Narratives in this thread are typically simple and serve as a framework to hang a series of comedic set-pieces. The story often involves a basic conflict or misunderstanding that quickly escalates into a chase or a sequence of increasingly absurd gags, concluding with a quick and happy resolution.

Why These Movies?

Movies are grouped here based on their shared commitment to physical humor, fast pacing, and a light, whimsical tone. They prioritize laughs and visual inventiveness over deep storytelling, creating a consistently energetic and playful viewing experience.

Fairy Tale Mashups like in The Bear’s Tale

Playful stories that twist and combine classic fairy tales for comedic effect.Fans of The Bear’s Tale who enjoyed its crossover of Little Red Riding Hood and The Three Bears will find more to love here. Discover similar movies and cartoons that playfully parody and mash up classic fairy tales with a comedic, lighthearted tone.

fairy taleparodycrossovermeta-humorwhimsicalfamily-friendlyfarcicalplayful

Narrative Summary

The narrative pattern involves taking established fairy tale archetypes and placing them in a new context or having them interact with characters from other stories. This leads to comedic misunderstandings, farcical situations, and a gentle parody of the original tales' conventions, always resolved happily.

Why These Movies?

These movies are united by their clever and affectionate twisting of fairy tale lore. They share a sense of playful irreverence, a focus on character crossover humor, and a vibe that is more silly than scary, making them perfect for lighthearted entertainment.

Unlock the Full Story of The Bear’s Tale

Don't stop at just watching — explore The Bear’s Tale in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what The Bear’s Tale is all about. Plus, discover what's next after the movie.

The Bear’s Tale Timeline

Track the full timeline of The Bear’s Tale with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

The Bear’s Tale Timeline

Characters, Settings & Themes in The Bear’s Tale

Discover the characters, locations, and core themes that shape The Bear’s Tale. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in The Bear’s Tale

The Bear’s Tale Spoiler-Free Summary

Get a quick, spoiler-free overview of The Bear’s Tale that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

The Bear’s Tale Spoiler-Free Summary

More About The Bear’s Tale

Visit What's After the Movie to explore more about The Bear’s Tale: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About The Bear’s Tale

Similar Movies to The Bear’s Tale

Discover movies like The Bear’s Tale that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.