El Chanfle 2

El Chanfle 2

Year: 1982

Runtime: 92 mins

Language: Spanish

FamilyComedy

Continuation of the 1979 film “El Chanfle”. It follows the stadium caretaker who works for a football team and his wife Tere, hoping for a child. The sequel shows his new misadventures as the team seeks success, with familiar characters returning, though Carlos Villagrán and Ramón Valdés are absent for health reasons. The humor appeals to all ages.

Warning: spoilers below!

Haven’t seen El Chanfle 2 yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – El Chanfle 2 (1982)

Trace every key event in El Chanfle 2 (1982) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Chanfle starts coaching Club América's niños

At the start of the sequel, El Chanfle is seen carrying out his new role as the coach of Club América's children's team. He embraces the position with enthusiasm and plans to train the kids for upcoming matches.

Beginning of film 2 Club América training grounds
2

Sr. Matute announces the symposium news and free attendance for Chanfle's family

With the eighth Club América symposium on the horizon, Sr. Matute tells his staff the news that Chanfle's wife Tere and their baby Theresa can attend at no cost. The revelation excites Chanfle, who shares the good fortune with his family.

Before the symposium Club offices
3

A new secretary replaces Diana

Sr. Matute appoints a new secretary, the cashier from Viana, following Diana's departure after she embezzled club funds. The club seeks reliability as they prepare for the symposium.

After Diana leaves Club offices
4

Diana falls into debt with a smuggler

Diana discovers her money troubles have attracted a smuggler. The man pressures her to repay by agreeing to work for him, pulling her deeper into danger.

After debt occurs Diana's workplace
5

Paco (El Chato) sacrifices money for the Taxco trip

To fund Diana's participation, Paco sacrifices their home repair money to pay for the trip to Taxco. He reluctantly accepts the personal cost for his wife’s assignment.

Before Taxco trip Home
6

Diana travels to Taxco to complete the job

Diana travels to Taxco with the stakeout mission: deliver a ball containing jewelry worth a million dollars to a contraband contact. The operation is dangerous and hinges on precise timing.

Taxco symposium period Taxco
7

A contact hands the ball to Cejudo at Buenos Aires airport; Diana later takes it from him

Before boarding the plane, another contact passes the ball to Sr. Cejudo at Buenos Aires airport. Later, Diana retrieves the ball in the hotel and delivers it to the contact who says 'The fifteen'.

Pre-departure to Taxco Buenos Aires / Taxco hotel
8

El Chanfle and the pool encounter reveal a key the wrong way

In the Taxco hotel pool, a contact wearing a white feathered hat meets El Chanfle, while Diana hands him a key she supposedly uses for recognition. The misidentification and confusing signals foreshadow the tangled chase to come.

During the symposium Taxco hotel pool
9

The 'bundle' turns out to be dirty diapers; payment is made

The famous bundle turns out to be Theresa's dirty diapers, not contraband. The contact identifies the bundle and pays Diana $25,000 as the agreed profit.

During the exchange Taxco hotel/meeting place
10

The stroller mix-up causes the ball to roll away

A cascade of mistakes leads to the ball being placed in a baby stroller. El Chanfle, assuming it's his baby's cart, grabs it and triggers a chaotic chase.

Climax of chase Parking lot / Taxco town
11

Chato/drunk and Dianna cause further confusion; the chase intensifies

Chato, drunk, mistakes the ball for his son and joins the fray, while Diana realizes the confusion has spiraled out of control. The pursuit spills into the park as people race to reclaim the ball.

Chase sequence Parking lot / park
12

Police are alerted; reward is offered

Diana informs Sr. Matute, prompting the police commander to offer a $10,000 reward for information. Tensions rise as authorities close in on the ball's whereabouts.

After the initial chase Club HQ / police
13

The truth about the ball's contents emerges; relief and confusion

The team learns that the 'ball' may hold signatures or is linked to a broader theft scheme, complicating who owns it. Sr. Cejudo’s identification of the thief resurfaces, reigniting efforts to recover the ball.

Revelation phase Hotel / Club
14

Resolution: the ball is recovered and the medical bill is settled

The ball is eventually recovered and the reward dispute is resolved: the doctor reveals that the team members shouldn't pay, and the money is returned to Tere. In a chaotic finale, Tere accidentally drops El Chanfle in his wheelchair down the stairs.

End of film Park / Hotel / Town

Last Updated: October 09, 2025 at 14:56

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Family comedies of errors like El Chanfle 2

Families getting hilariously tangled in a web of absurd misunderstandings and mishaps.If you liked the frantic misunderstandings and domestic chaos of El Chanfle 2, you'll enjoy these movies. This list features similar fast-paced family comedies where mistaken identities and absurd situations lead to hilarious, lighthearted farces perfect for all ages.

farcicalslapstickfreneticfamily-friendlysillyupbeatmisunderstandingsdomestic chaos

Narrative Summary

Stories in this thread typically start with a small, innocent mistake that snowballs into a dizzying chain of events. Characters are often well-intentioned but clumsy, leading to a frantic unraveling of the confusion before a happy, satisfying resolution that reinforces family bonds.

Why These Movies?

These movies are grouped together because they share a core formula of fast-paced, harmless farce centered on family life. They prioritize lighthearted humor over tension and use a cascade of comical errors to drive the plot, resulting in a cheerful and universally accessible viewing experience.

Hilarious sports farce movies like El Chanfle 2

Absurd and cheerful comedies where sports are a backdrop for comical chaos.Fans of El Chanfle 2 will love these comedies that blend sports with slapstick humor. Discover movies where the stadium, team, or sporting event becomes the perfect setting for a cascade of lighthearted, absurd, and fast-paced misadventures with a happy ending.

sports comedyabsurdunderdogslapsticklightheartedupbeatcamaraderiecheerful

Narrative Summary

The narrative pattern involves a lovable, often bumbling character connected to a sports team who gets caught up in an escalating series of comical problems. The sport itself provides a structure, but the real story is the character's journey through frantic chases and misunderstandings, culminating in a triumphant and funny resolution.

Why These Movies?

These films are united by their use of a sports backdrop to enable a specific type of accessible, physical comedy. They share a low-intensity, high-humor vibe where the stakes are personal and comical rather than truly competitive, making the sports setting fun and inclusive for non-fans.

Unlock the Full Story of El Chanfle 2

Don't stop at just watching — explore El Chanfle 2 in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending — every page helps you truly understand what El Chanfle 2 is all about. Plus, discover what's next after the movie.

El Chanfle 2 Summary

Read a complete plot summary of El Chanfle 2, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

El Chanfle 2 Summary

Characters, Settings & Themes in El Chanfle 2

Discover the characters, locations, and core themes that shape El Chanfle 2. Get insights into symbolic elements, setting significance, and deeper narrative meaning — ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in El Chanfle 2

El Chanfle 2 Spoiler-Free Summary

Get a quick, spoiler-free overview of El Chanfle 2 that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

El Chanfle 2 Spoiler-Free Summary

More About El Chanfle 2

Visit What's After the Movie to explore more about El Chanfle 2: box office results, cast and crew info, production details, post-credit scenes, and external links — all in one place for movie fans and researchers.

More About El Chanfle 2