The City of the Dead

The City of the Dead

JustWatch#9,69120

Year: 1960

Runtime: 78 mins

Language: English

Director: John Llewellyn Moxey

HorrorMystery

Visiting a quiet Massachusetts town to study witchcraft, a college student checks into a foreboding inn. She discovers the residents are a hidden community of 300‑year‑old beings who survive by feeding on human blood, granting them unnatural immortality. The truth forces her to confront the chilling secret lurking beneath the town’s calm facade.

Warning: spoilers below!

Haven’t seen The City of the Dead yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – The City of the Dead (1960)

Trace every key event in The City of the Dead (1960) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

1692: Selwyn is Burned and Binds a Pact

Elizabeth Selwyn is burned at the stake in Whitewood. Before dying, she and Jethrow Keane sell their souls to Lucifer in exchange for immortality and vengeance, binding themselves to the town's fate. The Devil's terms demand two yearly virgin sacrifices on the Hour of Thirteen during Candlemas Eve and the Witches' Sabbath.

1692 Whitewood, Massachusetts
2

The Covenant: Two Annual Sacrifices

The pact ensures Whitewood remains under Selwyn's influence, with two annual virgin sacrifices required each year. Candlemas Eve and the Witches' Sabbath become ritual anchors for Selwyn's immortality and the coven's power. The town's terror persists across generations.

1692 Whitewood
3

Present-day Professor Recommends a Field Trip

After lecturing on witchcraft, Professor Alan Driscoll suggests Nan Barlow visit Whitewood during her vacation to study its history firsthand. He emphasizes the town's notoriety and the occult narratives surrounding it. Nan accepts the assignment as part of her research.

Present day University
4

Nan Arrives at The Raven's Inn

Nan settles into The Raven's Inn, run by the eccentric Mrs. Newless, and becomes acquainted with Patricia Russell. Patricia lends Nan a book on witchcraft and hints that Candlemas Eve holds real significance in Whitewood. Nan's curiosity deepens as she prepares to uncover the town's secrets.

Present day, Candlemas Eve The Raven's Inn, Whitewood
5

Lure to the Basement and the Sacrifice

Nan is lured to the basement where she is restrained on a satanic altar by Mrs. Newless and coven members. Mrs. Newless at last reveals herself as Elizabeth Selwyn and confirms the ritual plan. The ritual on Candlemas Eve proceeds as the coven closes in on its planned sacrifice.

Present day, Candlemas Eve night The Raven's Inn basement
6

Nan's Sacrifice is Carried Out

Nan's struggle ends as the coven completes the ritual for Selwyn. The basement darkens with chants as the victim is offered to the coven. Her disappearance leaves Nan's fiancé and brother with mounting fear back home.

Present day, Candlemas Eve night The Raven's Inn basement
7

Investigation Starts: The Inn's Disappearance

Two weeks after Nan vanishes, Bill Maitland and Richard learn that The Raven's Inn does not appear in any phone directory. Patricia approaches them with concern, and they decide to travel to Whitewood to search for Nan. The case turns increasingly dire as rumors of witchcraft resurface.

Two weeks later Whitewood
8

Bill Survives a Sinuous Car Crash

En route to Whitewood, Bill experiences a terrifying apparition of Selwyn that causes a near-fatal car crash. He survives but is gravely wounded, fueling the sense that the coven's power still stalks the town. The incident deepens the trio's resolve to uncover the truth.

Two weeks later On the road toward Whitewood
9

Richard Encounters Patricia and the Reverend

Richard reaches Whitewood, reunites with Patricia, and they visit Patricia's grandfather, Reverend Russell. He reveals that Whitewood has fallen under Selwyn's coven control, linking the present danger to the ancient pact. The revelation confirms the town's malevolent ancestry persists.

Two weeks later Whitewood
10

Patricia Is Kidnapped; Graveyard Confrontation

Patricia becomes another coven sacrifice as the coven closes in. Richard makes a frantic attempt to save her, and they are cornered in the graveyard. The confrontation tightens the net around the town's cursed history.

Two weeks later Whitewood graveyard
11

Driscoll Exposed as Coven Member

Professor Driscoll is revealed to be a member of the coven, tying the academic world to the town's occult conspiracy. His involvement signals that the danger is not limited to the town's past but is active in the present. The revelation elevates the stakes for Nan, Bill, and Richard.

Present day Whitewood
12

Bill Arrives with a Crucial Tool

A severely injured Bill arrives at the last moment and pulls a large wooden cross from the ground. He uses the cross to drive back the coven as Selwyn wounds him gravely. The artifact becomes a symbol of the town's salvation effort.

Present day Whitewood
13

Selwyn's Downfall and the Charred Discovery

Bill's persistence leads to the coven's destruction as they are set ablaze under the cross's shadow. Selwyn escapes during the chaos, but the final blow undoes her pact with the Devil. Richard and Patricia later discover Selwyn's charred corpse in a hotel built on the site of her burning.

Present day Hotel on the site of Selwyn's burning, Whitewood

Last updated: October 05, 2025 at 12:31

Was this helpful?

The City of the Dead (1960) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the The City of the Dead (1960) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why did Professor Driscoll send Nan to Whitewood?

A.

Professor Driscoll was actually a member of Elizabeth Selwyn's coven. He deliberately recommended Whitewood to Nan so the coven could use her as the Candlemas Eve sacrifice. As a history professor specializing in witchcraft, he had the perfect cover to identify and lure young women to the town.

Driscoll's lecture on witchcraft at the beginning establishes his deep knowledge of the occult, which later explains his secret involvement with Selwyn's coven.

professor driscollnan barlowwhitewoodcovensacrificemotive
Q2

How did Elizabeth Selwyn become immortal?

A.

In 1692, before being burned at the stake, Elizabeth Selwyn and her accomplice Jethrow Keane sold their souls to Lucifer in exchange for eternal life and vengeance on Whitewood. The pact required two yearly virgin sacrifices on the Hour of Thirteen during Candlemas Eve and the Witches' Sabbath to maintain her immortality.

The opening scene in 1692 establishes the supernatural deal that powers the entire story.

elizabeth selwynimmortalitypactlucifersoulsacrifice
Q3

What is Candlemas Eve and why does it matter?

A.

Candlemas Eve is one of the two annual dates when the coven must offer a virgin sacrifice to fulfill their pact with the Devil. It occurs on February 2nd and marks one of the two required offerings that sustain Selwyn's immortality. The other is the Witches' Sabbath.

Patricia hints to Nan that Candlemas Eve holds real significance in Whitewood, but Nan doesn't realize it's literally the night of her sacrifice.

candlemas evesacrificeritualcovendevil pact
Q4

Why was Nan Barlow targeted for sacrifice?

A.

Nan was chosen because she was a young woman and a virgin who came to Whitewood during Candlemas Eve, exactly when the coven needed their annual sacrifice. Her visit during the specific time period, combined with Professor Driscoll's deliberate recommendation, made her the perfect victim.

Patricia lends Nan a book about witchcraft and warns her about Candlemas Eve, subtly hinting at the danger Nan is walking into.

nan barlowsacrificevirgincandlemas evetargeted
Q5

How did Bill survive the car crash caused by Selwyn's apparition?

A.

Bill survived because the apparition of Elizabeth Selwyn that appeared on the road was a supernatural intimidation tactic rather than a direct fatal attack. The crash was severe enough to gravely injure him, but he managed to reach Whitewood with his life, allowing him to arrive just in time for the final confrontation.

The earlier scene where Selwyn's ghost appears to Bill establishes her ability to project terrifying visions that can affect the physical world.

bill maitlandcar crashselwynapparitionsurvive
Q6

Why was Patricia Russell kidnapped by the coven?

A.

Patricia was kidnapped because she was the second sacrifice needed for that year's ritual cycle. After Nan was sacrificed on Candlemas Eve, the coven required another virgin sacrifice to complete their annual obligations. Patricia became the next target when the coven needed to fulfill both ritual dates.

Patricia's warning to Nan about Candlemas Eve and her obvious knowledge of the town's secrets make her a liability to the coven.

patricia russellkidnappedsacrificecovenvirgin
Q7

How did the wooden cross defeat the coven members?

A.

Bill pulled a large wooden cross from a grave in the graveyard and used it to drive back the coven members. When he lifted the cross, the coven members became trapped in its shadow and were burned alive. The cross represented divine power that could counteract the demonic pact, acting as a counter-spell to Selwyn's dark magic.

The scene where Bill finds the cross in the graveyard builds tension as the protagonists realize they have found a weapon against the immortal witches.

wooden crosscovenburndivine powershadow
Q8

What happened to Elizabeth Selwyn at the end of the movie?

A.

Selwyn was burned to death in the final confrontation when the coven was destroyed under the cross's shadow. However, she initially escaped during the chaos. Richard and Patricia later discovered her charred corpse in the hotel that was built on the exact site where she was burned in 1692, completing the circular justice of her fate.

The revelation that The Raven's Inn was built on the site of Selwyn's burning foreshadows her ultimate return to that location in death.

elizabeth selwyndeathcharred corpsehotelburned
Q9

Why was Professor Driscoll part of the coven?

A.

Professor Driscoll joined the coven to gain access to immortality, similar to Selwyn's own pact with the Devil. His position as a university history professor gave him the perfect cover to identify potential victims and lure them to Whitewood under the guise of academic research.

Driscoll's extensive knowledge of witchcraft, demonstrated in his university lecture, hints at his deeper involvement with the occult.

professor driscollcovenmembershipimmortalityteacher
Q10

Why did Selwyn escape the fire at first before dying?

A.

Selwyn initially escaped the fire because her pact with the Devil granted her powerful immortality that protected her from the flames. However, her pact was being undone by the counter-magic of the cross, and she was severely weakened. Richard and Patricia later found her already-dead charred body in the hotel, indicating the delayed effect of the divine intervention finally caught up with her.

Bill's use of the cross creates a spiritual backlash against the demonic pact, which progressively weakens Selwyn's supernatural protections.

selwynescapefirepactweakeneddeath
Q11

What is the Hour of Thirteen in the movie?

A.

The Hour of Thirteen refers to 1:00 AM, which is the specific time when the sacrifice ritual must be performed. According to the terms of Selwyn's pact with Lucifer, the virgin sacrifice must be offered at exactly this supernatural hour during Candlemas Eve and the Witches' Sabbath.

The coven's careful timing of Nan's sacrifice to occur at this specific hour reflects the rigid contractual nature of their demonic agreement.

hour of thirteensacrificeritualmidnighttime
Q12

What was Reverend Russell's role in Whitewood?

A.

Reverend Russell was Patricia Russell's grandfather and the one who revealed to Richard that Whitewood was under Selwyn's coven control. Despite being a man of faith in a town ruled by dark forces, he lacked the power to stop the coven. His knowledge came from generations of fighting against the supernatural evil in Whitewood.

Patricia's connection to the Reverend establishes her as someone with hidden knowledge about the town's true nature.

reverend russellpatriciagrandfatherwhitewoodrevelation
Q13

Why does The Raven's Inn not appear in any phone directory?

A.

The Raven's Inn doesn't exist in any phone directory because it only appears to those who are meant to find it as part of the coven's trap. The inn and the entire town of Whitewood operate under a supernatural veil that conceals them from the outside world, making it nearly impossible for outsiders to investigate or access the location normally.

Bill and Richard's discovery that the inn has no listing is the first clue that something unnatural protects Whitewood from outside scrutiny.

raven's innphone directorywhitewoodhiddenconcealed
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Gothic small-town horror movies like The City of the Dead

Stories where a quaint community hides a deep supernatural secret.If you enjoyed the eerie atmosphere and sinister secrets of The City of the Dead, explore more movies like it. This list features similar horror stories set in isolated communities with dark pasts, where uncovering the truth comes with deadly consequences. Discover films that capture the same feeling of foreboding and gothic suspense.

gothiceerieforebodingclaustrophobicsinisterancient evilsmall town secret

Narrative Summary

The narrative typically follows an outsider, often an investigator or academic, who arrives in a seemingly peaceful town only to uncover a centuries-old supernatural threat. The plot unfolds as a mystery, with the protagonist piecing together clues while their suspicion of the townspeople grows, leading to a confrontation with an ancient evil.

Why These Movies?

These films are grouped together for their shared focus on a specific, oppressive setting and the classic horror trope of a community-wide conspiracy. They all generate tension through atmosphere, slow reveals, and the theme of innocence confronting deeply entrenched, ritualistic evil.

Movies about uncovering witch cults like The City of the Dead

Thrillers where a protagonist investigates a hidden, immortal cult.For viewers who liked the satanic conspiracy and investigation plot in The City of the Dead, this list recommends similar movies. These films follow protagonists as they uncover hidden covens, dark rituals, and immortal beings, delivering a heavy, intense horror experience with a focus on witchcraft and survival.

investigativesatanicritualisticmenacingdreadsupernatural horrorsurvival

Narrative Summary

The plot follows a clear investigative arc where a character, driven by study or personal quest, methodically uncovers evidence of a cult's existence and their monstrous practices, such as blood sacrifices for immortality. The journey is linear, moving from skepticism to horrifying confirmation and a final, often costly, confrontation.

Why These Movies?

These movies are united by a specific plot pattern: the investigation of a hidden satanic or witch cult. They share a dark tone, high intensity from themes of human sacrifice, and a straightforward narrative structure that focuses on the slow, dreadful unveiling of a supernatural conspiracy.

Unlock the Full Story of The City of the Dead

Don't stop at just watching - explore The City of the Dead in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what The City of the Dead is all about. Plus, discover what's next after the movie.

The City of the Dead Summary

Read a complete plot summary of The City of the Dead, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

The City of the Dead Summary

Characters, Settings & Themes in The City of the Dead

Discover the characters, locations, and core themes that shape The City of the Dead. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in The City of the Dead

The City of the Dead Spoiler-Free Summary

Get a quick, spoiler-free overview of The City of the Dead that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

The City of the Dead Spoiler-Free Summary

More About The City of the Dead

Visit What's After the Movie to explore more about The City of the Dead: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About The City of the Dead

Similar Movies to The City of the Dead

Discover movies like The City of the Dead that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.