Revanche

Revanche

JustWatch#4,61224

Year: 2009

Runtime: 121 min

Language: German

Director: Götz Spielmann

DramaThrillerRomanceCrime

A former convict seeking a fresh start becomes entangled with a Ukrainian prostitute in Vienna, leading to a desperate and dangerous escape. Their lives intersect with a rural police officer and his wife, setting in motion a tense thriller that explores themes of vengeance, redemption, and the complexities of human nature. The film delves into the darker aspects of existence as the characters navigate a web of violence and unexpected beauty.

Where to Watch Revanche?

Find where to stream, rent, or buy Revanche (2009) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Warning: spoilers below!

Haven’t seen Revanche yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Revanche (2009)

Trace every key event in Revanche (2009) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Alex, ex-convict in Vienna, starts with Tamara

Alex, an ex-convict living in Vienna, works as muscle at a local brothel. He begins a relationship with Tamara, a Ukrainian prostitute who works there. They hatch a plan to rob a nearby bank and disappear together to start a new life.

Vienna, Austria
2

Plotting a bank heist and an escape to Hausner's farm

Alex and Tamara lay out a plan to rob a bank in a small village near Hausner's farm. He invites Tamara to join him, despite her anxiety, to share the risk. The plan is to flee to Hausner's farm after the heist and then leave for a new life.

Small village near Hausner's farm
3

Bank robbery and Tamara's death outside the bank

They approach the bank and encounter a local policeman named Robert outside. During the escape, Tamara is shot and killed when Robert fires at their fleeing car. An anguished Alex escapes and retreats to Hausner's farmland as planned.

Outside the village bank
4

Alex hides at Hausner's farm as Tamara dies

With Tamara dead, Alex goes into hiding at Hausner's farm as his plan dictates. Hausner's health begins to fail during this time, adding tension. Alex contemplates staying to look after the property and the old man.

Hausner's farm
5

Robert and Susanne's troubled marriage

Robert's marriage to Susanne is strained by infertility and unresolved guilt over the shooting. Susanne remains close to Hausner's family as a neighbor and friend, and the pressure worsens their relationship. The emotional tension creeps through their circle.

Hausner's neighborhood and nearby home
6

Susanne visits the farm; Alex learns the shooter, begins stalking

Susanne visits the farm, forming a fragile friendship with Hausner's household. Through conversations, Alex realizes Susanne's husband was the bank shooter, Robert. This realization drives Alex to begin stalking Robert with a loaded gun.

Hausner's farm
7

Susanne propositions; affair begins

During a visit to the farm, Susanne propositions Alex and they begin an affair. The secret relationship flourishes amid guilt and fear. Robert remains unaware at first, heightening the tension in their lives.

Hausner's farm
8

Robert's panic attack and suspension

Robert suffers a panic attack at work and is put on suspension. He opens up to Susanne about his guilt and self-loathing over the shooting. The affair between Alex and Susanne further complicates the situation.

Robert's police work
9

Confrontation in the woods; veiled questions

Alex confronts Robert in the woods, asking about the shooting in veiled terms. Robert admits his regret but also chastises the robber for bringing Tamara along. After the exchange, Alex leaves, and the tension between them lingers.

Woods near Hausner's farm
10

Alex discards his gun in the pond

After the confrontation, Alex quietly throws his gun into the pond, signaling a withdrawal from violence. He returns to life on the farm, reassessing his plans for the future. The disposal marks a turning point in their feud.

Pond by the farm
11

Hausner's health deteriorates; Alex stays to care for the farm

Hausner's health deteriorates, and Alex resolves to stay at the farm and look after it in his stead. He shifts from a temporary helper to a caretaker of the property and the old man. The decision locks him into life on the countryside despite their past turmoil.

Hausner's farm
12

Susanne becomes pregnant by Alex

Susanne becomes pregnant, claiming the child is Robert's. In truth the baby is fathered by Alex, even as the story implies Robert's paternity. The revelation underscores the tangled web of love, guilt, and deception around the farm.

Hausner's farm
13

Susanne discovers Tamara's photo; realizes Alex was robber

Susanne visits Alex to end their affair and recognizes a photo of Tamara, realizing Alex was the bank robber. The realization reshapes her understanding of the past and her relationship with both men. The truth sets the stage for continued secrecy and quiet consequences.

Hausner's farm
14

Alex keeps secret and returns to farm life

Alex agrees to keep their tryst a secret and vows not to harm Robert further. He returns to his work on the farm and stays, at least for now, in Hausner's care. The chapter closes with an uneasy, unresolved future.

Hausner's farm

Last updated: October 10, 2025 at 16:05

Was this helpful?

Revanche (2009) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Revanche (2009) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why did Alex involve Tamara in the bank robbery despite her anxiety?

A.

Alex wanted Tamara to share in their new life together and believed the risk was worth the reward. He thought having her as a partner in the crime would create mutual involvement and commitment, making it harder for her to leave him once they had the money. However, this decision proved tragic when Tamara was killed during the escape.

Earlier in the brothel, Tamara is described as anxious and clingy, which foreshadows her unsuitability for a dangerous heist.

tamaraalexbank robberyescapeviennaukrainian prostitute
Q2

Why did Robert shoot at the escaping car, resulting in Tamara's death?

A.

Robert, a local policeman, fired at the fleeing vehicle as part of his duty to stop the bank robbers. While his intent was to halt the criminals, the shot accidentally struck Tamara in the chaos of the escape. This tragic outcome haunted Robert throughout the film, creating overwhelming guilt.

The brief confrontation at the bank sets the violent tone that will define Robert's guilt throughout the story.

roberttamarashootingbank robberyvillage policemandeath
Q3

Why did Alex choose not to kill Robert after learning he was the shooter?

A.

After confronting Robert in the woods and hearing his genuine remorse, Alex realized that killing Robert would not bring Tamara back and would only perpetuate violence. He discarded his gun in the pond, symbolizing his choice to abandon revenge and pursue a different path. This decision represents his redemption arc.

Alex's initial stalking of Robert with a loaded gun shows his desire for vengeance, making his later choice to abandon violence more meaningful.

alexrobertrevengeconfrontationwoodsgunredemption
Q4

Why did Susanne begin an affair with Alex at the farm?

A.

Susanne's marriage to Robert was already strained by their infertility struggles and his emotional distance following the shooting. At the farm, she found emotional connection with Alex, who was also grieving and conflicted. Their affair represented a moment of mutual vulnerability and escape from their respective troubles.

Susanne's visits to Hausner's farm as a friendly neighbor establish her presence before the affair begins.

susannealexaffairrobertmarriageinfertilityguilt
Q5

Why did Susanne claim the baby was Robert's when it was actually Alex's?

A.

Susanne needed to maintain her social standing and marriage by presenting the pregnancy as Robert's child. By claiming the baby belonged to Robert, she avoided scandal and preserved her relationship with her husband. This deception further complicates the web of secrets among the four characters.

The tension in Robert and Susanne's marriage over infertility sets up the irony of her seeking pregnancy elsewhere.

susannepregnancyaffairdeceptionrobertalexbaby
Q6

Why did Alex remain at Hausner's farm instead of leaving Vienna?

A.

After Tamara's death and his failed robbery, Alex retreated to the farm as originally planned. With Hausner's health declining, Alex found purpose in caring for the elderly man and the land. The farm became his place of redemption and a new identity, replacing his original plan to escape.

Alex's original plan involved using Hausner's farm as a hiding spot before leaving for a new life, but circumstances changed his trajectory.

alexhausnerfarmcaretakerviennaredemptionnew life
Q7

How did Susanne discover Alex was the bank robber?

A.

During a visit to end their affair, Susanne saw a photo of Tamara in Alex's room. Recognizing Tamara from the news about the bank robbery, she realized Alex was one of the robbers. This revelation changed her perception of him entirely.

Susanne's earlier curiosity about Alex's background sets up her discovery of the photo.

susannealextamaraphotodiscoverybank robberexposure
Q8

What did Alex throwing his gun into the pond signify?

A.

By discarding his gun, Alex symbolically rejected his desire for revenge and violent retribution. The act marked a turning point where he chose to move forward with his life rather than seek vengeance for Tamara's death. It represents his moral transformation.

Alex's earlier stalking of Robert with the loaded gun builds toward this moment of releasing his violent intentions.

alexgunpondrevengeviolenceabandonmenttransformation
Q9

Why did Robert have a panic attack at work after the shooting?

A.

Robert's panic attack stemmed from the overwhelming guilt and psychological trauma of accidentally killing Tamara. The weight of taking a life, combined with the strain on his marriage, became unbearable. His suspension from work allowed him to confront his actions directly.

Robert's growing guilt throughout the film culminates in this breakdown.

robertpanic attackguiltpolice worktraumasuspension
Q10

Why did Alex work as muscle at the brothel in Vienna?

A.

After being released from prison, Alex needed employment and found work as a bouncer or muscle at the brothel where Tamara worked. This job provided him income while he plotted his next move and created the opportunity to meet and form a relationship with Tamara.

Alex's criminal background establishes why he gravitated toward underworld employment.

alexbrothelviennamuscleex-convictemployment
Q11

What role does Hausner's farm play in the story?

A.

Hausner's farm serves as the central location where the fates of all characters intersect. It provides Alex with a refuge after the robbery, becomes the site of Alex and Susanne's affair, and gives Alex a purpose through caring for the aging Hausner. The farm represents redemption and a new beginning.

Alex's plan to flee to his grandfather's farm after the robbery establishes its importance from the beginning.

hausnerfarmruralviennarefugeintersectionnew life
Q12

Why did Alex confront Robert in the woods instead of shooting him?

A.

Alex's confrontation was a way to face his enemy directly and test Robert's conscience. Rather than acting impulsively, he wanted Robert to acknowledge his crime and show remorse. The veiled conversation allowed Alex to gauge whether Robert deserved vengeance.

Alex's earlier stalking behavior builds toward this direct confrontation.

alexrobertconfrontationwoodsremorseveiled conversationrevenge
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies about moral crossroads after tragedy like Revanche

Characters face heavy consequences and ethical dilemmas in a bleak, unforgiving world.If you liked the complex ethical dilemmas and heavy consequences in Revanche, explore these other films. This collection features morally gray thrillers and dramas where characters face life-altering choices after a devastating event, blending suspense with deep thematic exploration.

grittymorally ambiguoustensemelancholicdesperatereflectiveoppressive

Narrative Summary

Narratives typically begin with or are triggered by a single, often violent, tragedy that shatters the characters' lives. The plot then focuses on the fallout, as protagonists grapple with guilt, a desire for revenge, and the possibility of redemption. The journey is less about external action and more about an internal moral struggle, often leading to a bittersweet or ambiguous resolution.

Why These Movies?

Movies are grouped here for their shared focus on the ethical and emotional fallout of a single event. They share a dark, gritty tone, high emotional weight, and a narrative structure that prioritizes character psychology and moral complexity over clear-cut heroes and villains.

Slow burn rural thrillers with tense atmospheres like Revanche

Quiet, atmospheric thrillers where isolation and simmering dread lead to explosive confrontations.Fans of the quiet, simmering tension and rural setting of Revanche will appreciate these selections. This list features atmospheric thrillers and dramas where a slow pace and isolated locations build a palpable sense of dread, leading to morally complex and emotionally charged conclusions.

slow burntenseatmosphericoppressivequietsuspensefulmelancholicgritty

Narrative Summary

Stories unfold at a deliberate pace, using the isolation and quiet of a rural environment to amplify internal conflicts and simmering resentments. The tension builds gradually through quiet moments and lingering shots, rather than fast-paced action, often culminating in a violent or emotionally devastating climax that feels both shocking and inevitable.

Why These Movies?

These films are connected by their distinctive pacing and atmosphere. They share a slow-burn approach to suspense, a heavy, often melancholic mood, and a setting that becomes a character in itself, reflecting the internal turmoil of the protagonists.

Unlock the Full Story of Revanche

Don't stop at just watching - explore Revanche in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Revanche is all about. Plus, discover what's next after the movie.

Revanche Summary

Read a complete plot summary of Revanche, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Revanche Summary

Characters, Settings & Themes in Revanche

Discover the characters, locations, and core themes that shape Revanche. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Revanche

Revanche Spoiler-Free Summary

Get a quick, spoiler-free overview of Revanche that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Revanche Spoiler-Free Summary

More About Revanche

Visit What's After the Movie to explore more about Revanche: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Revanche

Similar Movies to Revanche

Discover movies like Revanche that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.