I Still Believe

I Still Believe

JustWatch#26,4871

Year: 2020

Runtime: 116 min

Language: English

Directors: Andrew Erwin, Jon Erwin

Echo Score: 55

Budget: $12M

BiographyDramaRomanceMusic

Jeremy Camp, a rising Christian music star, experiences profound loss when his wife, Melissa, tragically passes away. Overwhelmed by grief, he channels his pain into his debut songs, struggling to cope with the immense sadness. Despite his heartbreak, Camp remains steadfast in his faith, finding solace and strength through his beliefs. The film portrays his journey of healing and hope, based on a true story.

Where to Watch I Still Believe?

Find where to stream, rent, or buy I Still Believe (2020) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Warning: spoilers below!

Haven’t seen I Still Believe yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – I Still Believe (2020)

Trace every key event in I Still Believe (2020) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Jeremy's New Beginning

In September 1999, Jeremy Camp leaves his hometown of Lafayette, Indiana, to pursue his dreams at Calvary Chapel College in Murrieta, California. This marks the start of an exciting new chapter in his life, filled with opportunities for growth and music.

September 1999 Calvary Chapel College, Murrieta, California
2

The Concert Encounter

On his first night at college, Jeremy attends a concert performed by the Canadian band, the Kry. It is during this event that he meets their lead singer, Jean-Luc LaJoie, who becomes a pivotal mentor in Jeremy's musical journey.

Concert Venue, Murrieta, California
3

Meeting Melissa

Through Jean-Luc, Jeremy meets Melissa Henning, a fellow student and close friend of Jean-Luc. Despite her connection with Jean-Luc, Melissa finds herself increasingly drawn to Jeremy, sparking the beginning of a deep bond between them.

4

Heartbreak

As Jeremy and Melissa's relationship deepens, it leads to internal conflict among the trio, culminating in Melissa choosing to end her romantic relationship with Jeremy. Heartbroken, Jeremy returns to his family home in Indiana to regroup during the Christmas break.

Christmas 1999 Jeremy's Family Home, Indiana
5

A Troubling Revelation

Jeremy receives a distressed call from Jean-Luc alerting him that Melissa is critically ill. He learns that Melissa's health has deteriorated severely, prompting him to immediately return to California to support her.

Hospital, California
6

Devastating Diagnosis

Upon his arrival, Jeremy visits Melissa in the hospital and is devastated to hear that she has been diagnosed with Stage 3C ovarian cancer. In a heartfelt moment, Melissa confesses her love for Jeremy, leading him to propose to her during this time of crisis.

Hospital Room, California
7

A Moment of Hope

As their relationship flourishes, Jeremy is inspired to pursue a music career while Melissa undergoes medical treatments. After an MRI reveals troubling news about her cancer, Melissa miraculously learns that the cancer has vanished right before her scheduled operation.

Hospital, California
8

Vows of Love

Jeremy and Melissa's love culminates in a joyful wedding ceremony. As they exchange vows, their hearts are filled with happiness, but they are still haunted by the uncertainties surrounding Melissa's health.

Wedding Venue, California
9

The Return of Cancer

Shortly after their marriage, Jeremy and Melissa receive the crushing news that her cancer has returned, with no further treatment options available. This moment brings renewed fears and challenges to their once blissful life together.

10

Struggles of Faith

As Melissa's health declines, Jeremy battles with his faith and deep emotional turmoil. During their honeymoon, he performs 'Walk by Faith,' a song that reflects on his journey of grief, capturing both his anguish and hope.

Honeymoon Destination
11

Tragic Loss

In a devastating turn of events, Melissa passes away, leaving Jeremy in utter despair. He grapples with his sorrow, leading him to express his pain by shattering his guitar, a poignant symbol of his lost dreams.

12

A Lasting Message

While dealing with his grief, Jeremy finds a note left by Melissa inside his guitar. Her words serve as a reminder that faith can be strengthened through suffering, igniting a resolve in him to continue writing and performing.

13

Rebirth Through Music

Jeremy returns to the stage, pouring his heart into a song titled 'I Still Believe.' This powerful performance encapsulates his emotional journey and serves as a testament to the healing power of music during his darkest times.

Concert Stage
14

New Connections

Post-performance, Jeremy meets Adrienne, who relates to his struggles and finds hope in his music. Their connection blossoms from shared experiences of sorrow and healing, providing both with renewed purpose.

15

A Beautiful Life

As time passes, Jeremy and Adrienne build a fulfilling life together, enriched by love and family. Their journey underscores the indomitable spirit of hope, reflected in the three beautiful children they raise together.

Last updated: November 19, 2024 at 12:41

Was this helpful?

I Still Believe (2020) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the I Still Believe (2020) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why did Melissa break up with Jeremy?

A.

Melissa ended her relationship with Jeremy because of the complicated dynamic between the three of them. Since Melissa was a close friend of Jean-Luc LaJoie (the lead singer Jeremy had just met), their growing romantic relationship created tension and awkwardness. Melissa chose to step away from Jeremy to resolve this emotional conflict, leading Jeremy to return to Indiana heartbroken during Christmas.

Earlier, the movie establishes that Melissa met Jeremy through Jean-Luc, hinting at the complicated friendship dynamic that would later cause tension.

melissa henningbreak upjean-lucrelationshipcollege
Q2

What happened to Melissa's cancer in the movie?

A.

Melissa was diagnosed with Stage 3C ovarian cancer that had spread to her liver. After undergoing an MRI that showed the cancer had spread to her ovaries (requiring a hysterectomy), she was scheduled for surgery. However, when she woke up from anesthesia, doctors told her the cancer had mysteriously vanished. Six months later, after Jeremy and Melissa married, the cancer returned and there were no further treatment options available.

The sudden remission is presented as a miraculous turn of events, contrasting with the subsequent return of the disease.

melissa cancerovarian cancerstage 3cremissiondiagnosis
Q3

Why did Jeremy destroy his guitar after Melissa died?

A.

After Melissa passed away, Jeremy was overwhelmed by grief and rage. He shattered his guitar in a moment of despair, symbolizing his complete emotional breakdown and his desire to abandon the music that now reminded him of his loss. However, while cleaning up, he discovered a note Melissa had hidden inside the guitar, which encouraged him to keep writing and performing.

The guitar had been a central part of their relationship, with Jeremy performing songs for Melissa throughout their courtship.

guitargriefdestroyedmelissa noteshattered
Q4

What was the note Melissa left for Jeremy?

A.

Melissa left a heartfelt note hidden inside Jeremy's guitar before she died. In it, she wrote that suffering can strengthen faith rather than destroy it. She encouraged Jeremy to continue writing songs and sharing their story with the world, believing it could inspire others. This note became the catalyst for Jeremy's return to music.

The note was hidden inside the guitar, a meaningful location given Jeremy's musical career and the songs he had written for her.

melissa noteletterguitarfaithinspiration
Q5

How did Jeremy meet Adrienne?

A.

Jeremy met Adrienne after performing his song "I Still Believe" at a concert. Adrienne approached him afterward and shared how his music had helped her cope with her own struggles and anger toward life. Their shared experiences of loss and healing created an instant connection, eventually leading to their marriage and family.

The film establishes early on that Jeremy's music ministry is about helping others through their struggles, setting the stage for this meaningful encounter.

adriennemeetingconcerti still believesecond marriage
Q6

What songs did Jeremy write about Melissa?

A.

Jeremy wrote several songs about his love for Melissa and his faith journey with her. The most prominent were "Walk by Faith," which he performed during their honeymoon and captured his grief and hope, and "I Still Believe," the powerful ballad he performed after her death that chronicled his journey through loss toward healing. These songs became central to his Christian music career.

Throughout the film, Jeremy is shown writing songs during key moments of their relationship, establishing his songwriting as a form of emotional expression.

walk by faithi still believesongsjeremy campchristian music
Q7

How long was Melissa sick before she died?

A.

From Melissa's initial cancer diagnosis to her death, the timeline spans several key moments: she became ill shortly after Jeremy returned to California (around late 1999), experienced a miraculous remission where the cancer vanished before her scheduled surgery, married Jeremy six months later, and then received news the cancer had returned with no treatment options. She passed away shortly after their honeymoon, meaning she was ill for approximately a year.

The timeline shows progressively worsening health despite brief periods of hope, building toward the inevitable tragic outcome.

timelinecancerillnessdiagnosisdeath
Q8

Why did Jean-Luc call Jeremy about Melissa being ill?

A.

Jean-Luc called Jeremy because he was deeply concerned about Melissa's condition and knew she was dying. Despite the tension in their earlier relationship triangle, Jean-Luc reached out to Jeremy because he understood how much Jeremy and Melissa meant to each other. This call prompted Jeremy to immediately return to California to be with Melissa during her final weeks.

Jean-Luc had previously been a mentor to Jeremy, establishing a foundation of trust that made this intervention possible.

jean-luccallmelissa illnesscaliforniareturn
Q9

Did Jeremy and Melissa have children together?

A.

No, Jeremy and Melissa did not have children together. Melissa was diagnosed with cancer shortly after they met, and her condition prevented them from having a family during their brief marriage. After Melissa's death, Jeremy later married Adrienne, and the film concludes showing them with three children together.

The film hints at Jeremy's desire for family through his eventual life with Adrienne, but Melissa's illness tragically prevented this during their marriage.

childrenfamilymelissajeremyadrienne
Q10

Is Jeremy Camp still alive and did he remarry?

A.

Yes, Jeremy Camp is still alive. After Melissa's death, he eventually married Adrienne Camp (née Lies), who was a fellow worship leader at his church. They have been married since 2003 and have three children together. Jeremy continues to be a successful Christian musician, and he and Adrienne often perform together.

The film concludes with Jeremy and Adrienne building a life together, showing the hopeful continuation of his story.

jeremy campalivemarriedadriennefamilycurrent
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies about grief healed by faith like I Still Believe

Stories where profound loss is met with spiritual strength and hopeful healing.If you appreciated the way I Still Believe used faith as an anchor through tragedy, you'll find similar comfort in these stories. This collection features movies where characters endure deep grief but find strength, hope, and eventual healing through their religious or spiritual beliefs, often based on true inspirational journeys.

inspirationalmelancholicfaith-drivengrievingreflectiveupliftingemotionalheartbreaking

Narrative Summary

The narrative pattern typically begins with a idyllic period disrupted by a sudden, tragic event like a terminal illness. The protagonist is plunged into deep grief and struggles with their faith, but instead of succumbing to despair, they channel their pain into a positive outlet—often art, service, or music—leading to a bittersweet but hopeful conclusion centered on spiritual growth.

Why These Movies?

These movies are grouped together because they share a specific emotional mix: they are unafraid to explore heavy themes of death and loss while maintaining a core of hopefulness derived from faith. The pacing is often steady and character-driven, focusing on an internal emotional journey rather than external action.

True tragic love stories like I Still Believe

True-life romances cut short by tragedy, leaving a legacy of love and art.For viewers who were moved by the true romance and tragedy in I Still Believe, this list features similar biographical films. Discover movies based on real couples whose love stories were profound but cut short, exploring how their legacy lives on through music, art, or inspirational acts, resulting in a deeply emotional and bittersweet experience.

romanticbittersweettragicbiographicalemotionalheartbreakinginspirationallegacy

Narrative Summary

These narratives follow a linear, straightforward structure tracing the meeting, intense connection, and joyful early days of a real-life couple. A central conflict arises, typically a terminal illness, which tests their bond. The story then shifts to how the surviving partner grapples with grief and honors their loved one's memory, often achieving public recognition for the art born from their pain.

Why These Movies?

Movies fit this thread because they blend the compelling elements of a true story, a central romantic plot, and a tragic turning point. They evoke a specific bittersweet feeling—celebrating the beauty of the love while mourning its loss—and often conclude with a message about legacy and enduring impact.

Unlock the Full Story of I Still Believe

Don't stop at just watching - explore I Still Believe in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what I Still Believe is all about. Plus, discover what's next after the movie.

I Still Believe Summary

Read a complete plot summary of I Still Believe, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

I Still Believe Summary

Characters, Settings & Themes in I Still Believe

Discover the characters, locations, and core themes that shape I Still Believe. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in I Still Believe

I Still Believe Spoiler-Free Summary

Get a quick, spoiler-free overview of I Still Believe that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

I Still Believe Spoiler-Free Summary

More About I Still Believe

Visit What's After the Movie to explore more about I Still Believe: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About I Still Believe

Similar Movies to I Still Believe

Discover movies like I Still Believe that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.