Quasi at the Quackadero

Quasi at the Quackadero

Year: 1976

Runtime: 10 mins

Language: English

ComedyAnimation

The surreal animated short follows the adventurous duo Quasi and Anita, along with their clever pet robot Rollo, as they venture into the Quackadero—a futuristic amusement park where thoughts, time, dreams and memories are turned into whimsical playthings for its delightfully odd and wacky clientele.

Where to Watch Quasi at the Quackadero?

Find where to stream, rent, or buy Quasi at the Quackadero (1976) in the US with current JustWatch availability, up-to-date pricing, and platform listings for subscription, rental, and digital purchase options.

Streaming availability powered by JustWatch

Warning: spoilers below!

Haven’t seen Quasi at the Quackadero yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline & Setting – Quasi at the Quackadero (1976)

Explore the full timeline and setting of Quasi at the Quackadero (1976). Follow every major event in chronological order and see how the environment shapes the story, characters, and dramatic tension.

Time period

The narrative unfolds in a timeless carnival where attractions bend time and memory. Visitors glimpse futures in the Hall of Time Mirrors, watch lives run backward in the Roll Back Time Machine, and peer into last night's dreams in Madame Xano's booth. The Time Holes reveal slices from three million years ago, highlighting the fantasy of time travel within the show.

Location

Quackadero, Coney Island

Quackadero is a neon-lit, Coney Island–style sideshow filled with oddities and carnival attractions. It features the Hall of Time Mirrors, the Roll Back Time Machine, the Think-o-Blink Machine, Madame Xano's dream booth, and the Time Holes. The setting is playful and surreal, blending performance with fantastical science.

🎪 Sideshow 🏖️ Boardwalk 🎨 Retro-futurist

Last updated: February 18, 2026 at 23:31

Was this helpful?

Main Characters – Quasi at the Quackadero (1976)

Meet the key characters of Quasi at the Quackadero (1976), with detailed profiles, motivations, and roles in the plot. Understand their emotional journeys and what they reveal about the film’s deeper themes.

Quasi (Kim Deitch)

An infantile duck with buck front teeth, thick glasses and a red cape, Quasi embodies childlike mischief. His bold, reckless behavior often provokes others, setting the story's conflict in motion. Despite his rudeness, he remains curious and adventurous, acting as the catalyst for the carnival's time-bending adventures.

🦆 Quirky 🧭 Curious 🧨 Mischievous

Anita (Sally Cruikshank)

Anita is described as 'Betty Boop with a New Wave wardrobe' with a Mae West-like voice. She orchestrates Quasi's removal, distracting him with chocolate cake and signaling Rollo to push him into the Time Hole. Her decisive, street-smart cunning drives the plan and showcases a harsher facet of carnival social dynamics.

🎭 Performer 🧠 Cunning 💃 Bold

Rollo

A robot companion to Anita, Rollo assists in the plan by signaling when to push Quasi into the Time Hole. He represents mechanized pragmatism within the carnival's imaginative world. The Time Hole sequence shows him contributing to the surreal, time-bending outcome.

🤖 Robot 🧠 Logical 🧩 Companion

Last updated: February 18, 2026 at 23:31

Was this helpful?

Major Themes – Quasi at the Quackadero (1976)

Explore the central themes of Quasi at the Quackadero (1976), from psychological, social, and emotional dimensions to philosophical messages. Understand what the film is really saying beneath the surface.

💔 Exclusion

Anita and Rollo's plan to banish Quasi exposes the harshness of exclusion within a close-knit group. Quasi's blunt mischief triggers social sanctions, revealing vulnerability beneath bravado. The sequence critiques bullying and the consequences of ostracizing a playful outsider.

⏳ Time

Time is a tangible element of the Quackadero, manipulated by its attractions. The hall of mirrors, time machine, and Time Holes defy ordinary chronology, inviting wonder and risk. The story uses these devices to explore curiosity about past and future and the effects of tampering with time.

🎭 Performance

The Quackadero operates as a stage where acts blur with magic, and the characters navigate performative roles. Showmanship shapes social dynamics as quests and schemes unfold within the carnival. The line between spectacle and reality remains deliberately playful and unstable.

Last updated: February 18, 2026 at 23:31

Was this helpful?

Quasi at the Quackadero (1976) Character & Theme Questions Answered – Info FAQ

Browse frequently asked questions about Quasi at the Quackadero (1976) focused on characters, relationships, themes, symbols, setting, and story context. This movie info FAQ gives spoiler-aware explanations for character arcs, world details, and thematic interpretation so readers can better understand what the film is really about.

Q1

What is the Quackadero and what makes it unique?

A.

The Quackadero is a neon-lit, Coney Island–style futuristic amusement park where thoughts, time, dreams, and memories are turned into whimsical attractions for its odd clientele. Unlike a typical carnival, it features surreal science-fiction rides like the Hall of Time Mirrors, the Roll Back Time Machine, and Time Holes that physically manipulate visitors' perception of time and reality.

quackaderoamusement parksurreal settingtime attractionscarnival
Q2

What time period is the movie set in?

A.

The Quackadero exists in a timeless carnival setting rather than a specific historical era. Its retro-futurist aesthetic blends vintage sideshow elements like Coney Island boardwalks with futuristic attractions that bend time and memory, creating a dreamlike environment outside ordinary chronology.

time periodtimeless settingretro-futuristcarnival era
Q3

Who is Quasi and what defines his personality?

A.

Quasi is an infantile duck with buck front teeth, thick glasses, and a red cape who embodies childlike mischief and bold recklessness. His curious and adventurous nature drives the story forward, though his rude behavior frequently provokes conflict with other characters, ultimately setting the film's central tension in motion.

quasicharacterduckmischiefpersonality
Q4

What role does Anita play in the story?

A.

Anita is described as Betty Boop with a New Wave wardrobe and possesses a Mae West-like voice. She serves as the clever schemer of the duo, orchestrating plans with street-smart cunning. Her decisive action in the film's climax reveals a harsher side to the carnival's social dynamics, showcasing how insiders protect their group.

anitacharacterschemeclevercarnival character
Q5

What is Rollo and what does he do?

A.

Rollo is a robot companion to Anita who assists in executing plans within the Quackadero. He represents mechanized pragmatism amidst the carnival's imaginative and surreal world. His role involves timing and coordination, particularly in the pivotal sequence involving the Time Hole.

rollorobotcompanionmechanized helper
Q6

What does the theme of exclusion explore in the movie?

A.

The Exclusion theme examines how Anita and Rollo's plan to banish Quasi exposes the harshness of social sanctions within close-knit groups. Quasi's blunt mischief triggers his removal, revealing vulnerability beneath his bravado. The film critiques bullying and the consequences of ostracizing a playful outsider from a community.

exclusionostracismbullyingsocial groupoutsider
Q7

How does the movie use time as a theme?

A.

Time in the Quackadero becomes a tangible, manipulable element rather than a fixed dimension. The attractions, the Hall of Time Mirrors, Roll Back Time Machine, and Time Holes, defy ordinary chronology, inviting both wonder and risk. The story explores curiosity about past and future while examining the consequences of tampering with time.

time traveltime manipulationchronologytime holeshall of mirrors
Q8

What does the performance theme represent?

A.

The Quackadero operates as a stage where acts blur with magic and characters navigate performative roles. Showmanship shapes social dynamics as quests and schemes unfold within the carnival setting. The film deliberately keeps the line between spectacle and reality playful and unstable, reflecting the performative nature of identity itself.

performanceshowmanshipcarnivalspectacleidentity
Q9

What is the overall tone and atmosphere of the film?

A.

The film maintains a dominantly whimsical tone thanks to its surreal animation style, absurd premise of a thought-reading amusement park, and quirky characters. Despite the darkly humorous betrayal at its end, the movie keeps emotional weight light, focusing on imaginative spectacle and humorous character interactions rather than heavy drama.

tonewhimsicalatmospheresurrealhumor
Q10

How should the ending's emotional tone be understood?

A.

The ending carries a bittersweet quality, while Quasi's fate serves as a prankish punishment, his eternal exile adds a melancholic undertone to what is otherwise an irreverent comedy. The emotional weight remains light overall, with tension and sadness minimal, allowing the imaginative spectacle to take precedence over tragic resolution.

endingbittersweetmelancholyemotional toneexile
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Surreal Worlds of Whimsical Logic like in Quasi at the Quackadero

Movies that build playful, dreamlike worlds where reality bends to absurd rules.Discover movies like Quasi at the Quackadero that feature surreal, dreamlike worlds with playful rules. These films share a sense of whimsical invention, immersing viewers in imaginative settings where logic is secondary to wonder.

surrealdreamlikeplayfulquirkyimaginativewhimsicalabsurdfantastical

Narrative Summary

Narratives in this thread often involve exploring a strange new environment or concept. The plot is less about a traditional conflict and more about the experience of navigating a world where normal rules don't apply, leading to a series of inventive and often humorous encounters.

Why These Movies?

These movies are grouped together because they prioritize a specific, inventive vibe over conventional storytelling. They share a commitment to visual creativity, a lighthearted tone, and a playful approach to reality that feels cohesive and distinct.

Bittersweet Endings in Lighthearted Tales like in Quasi at the Quackadero

Stories that blend humorous, whimsical journeys with a touch of poignant resolution.Find movies similar to Quasi at the Quackadero that mix playful comedy with a bittersweet conclusion. If you liked the humorous adventure and the touch of melancholy at the end, these films offer a similar emotional blend.

bittersweetplayfulquirkywhimsicalthought-provokingirreverentmelancholic

Narrative Summary

The narrative follows a cheerful, often chaotic adventure where characters experience comedic mishaps and whimsical events. The story builds to a conclusion that, while not tragic, introduces a note of irony, loss, or quiet reflection that contrasts with the preceding levity.

Why These Movies?

These films share a unique emotional recipe: a foundation of humor and whimsy capped with a poignant, thoughtful ending. This creates a memorable experience that feels more layered than pure comedy, appealing to viewers who enjoy a hint of depth with their delight.

Unlock the Full Story of Quasi at the Quackadero

Don't stop at just watching - explore Quasi at the Quackadero in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Quasi at the Quackadero is all about. Plus, discover what's next after the movie.

Quasi at the Quackadero Summary

Read a complete plot summary of Quasi at the Quackadero, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Quasi at the Quackadero Summary

Quasi at the Quackadero Timeline

Track the full timeline of Quasi at the Quackadero with every major event arranged chronologically. Perfect for decoding non-linear storytelling, flashbacks, or parallel narratives with a clear scene-by-scene breakdown.

Quasi at the Quackadero Timeline

Quasi at the Quackadero Spoiler-Free Summary

Get a quick, spoiler-free overview of Quasi at the Quackadero that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Quasi at the Quackadero Spoiler-Free Summary

More About Quasi at the Quackadero

Visit What's After the Movie to explore more about Quasi at the Quackadero: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Quasi at the Quackadero

Similar Movies to Quasi at the Quackadero

Discover movies like Quasi at the Quackadero that share similar genres, themes, and storytelling elements. Whether you’re drawn to the atmosphere, character arcs, or plot structure, these curated recommendations will help you explore more films you’ll love.