Don't Tempt Me

Don't Tempt Me

Year: 2003

Runtime: 112 min

Director: Agustín Díaz Yanes

Comedy

In a world where good and evil are at war, Heaven and Hell each deploy their most skilled agents. Lola Nevado, a powerful angel, confronts Carmen Ramos, a shrewd operative from Hell, in a battle for the soul of a struggling boxer. Their conflict determines the fate of both realms, demanding a decisive victory for either Heaven or Hell.

Warning: spoilers below!

Haven’t seen Don't Tempt Me yet? This summary contains major spoilers. Bookmark the page, watch the movie, and come back for the full breakdown. If you're ready, scroll on and relive the story!

Timeline – Don't Tempt Me (2003)

Trace every key event in Don't Tempt Me (2003) with our detailed, chronological timeline. Perfect for unpacking nonlinear stories, spotting hidden connections, and understanding how each scene builds toward the film’s climax. Whether you're revisiting or decoding for the first time, this timeline gives you the full picture.

1

Lola's Quest Begins

In the celestial realm of Heaven, Lola, a nightclub singer, is tasked by her boss, Marina, to salvage the soul of Manny, a Spanish boxer in distress. With Manny's career severely damaged due to brain injuries from his last fight, Lola's mission is pivotal to restoring hope in his life.

Heaven
2

Manny's Despair

Manny, struggling with the aftermath of his career-ending injuries, finds himself in a spiraling cycle of despair. Faced with enormous financial troubles, he contemplates giving up, while Lola takes on the guise of his estranged wife to reignite his spirit.

3

Carmen's Secret Mission

In the depths of Hell, waitress Carmen is given a secret directive by her boss, Davenport, to invigorate Manny's fighting spirit. Disguising herself as Manny's cousin, she moves into his flat, aiming to become a significant part of his life.

Hell
4

Contrasting Approaches

As Lola embodies humility and devotion in her efforts, Carmen presents the opposite approach with her vibrant sexuality and flamboyance. Both women work at a hypermarket, forming a bond over shared disdain for their oppressive workplace and understanding of the struggles around them.

Hypermarket
5

Thugs and Debt

Manny's situation worsens as he gets pursued by thugs sent by a corrupt police chief due to a hefty debt. Lola works tirelessly to shield Manny from further harm, while Carmen encourages him to reclaim his boxing career to settle his debts and escape his guilt.

6

Davenport's Dilemma

Back in Hell, Davenport faces pressure from within the management ranks threatening his position. In a strategic move to regain control, he allies with Marina, advocating for humanity's freedom of choice in their lives on Earth.

Hell
7

A Chance for Redemption

In a rare moment of clemency, Davenport allows Manny the opportunity for redemption, instructing Carmen to collaborate with Lola instead of undermining her efforts. This alliance could be the key to saving Manny from his dire state.

8

The Bold Heist

As tensions rise, Lola and Carmen concoct a daring plan to rob the hypermarket, hoping to use the stolen cash to pay off Manny's debts. They storm the cashier's office but are met with gunfire, leading to a chaotic escape.

Hypermarket
9

The Fatal Encounter

After successfully fleeing with the cash, Lola and Carmen return to Manny's apartment, only to find themselves ambushed by the corrupt police chief. In a tragic turn of events, Manny sacrifices himself to ensure the women's escape, ultimately succumbing to his injuries.

Manny's Apartment
10

Manny's Ascendance

In the aftermath of his selfless act, Manny ascends to the celestial realm, rewarded for his moral courage. His journey portrays the significance of sacrifice and bravery despite facing overwhelming darkness.

Heaven
11

Imprisoned Fate

Meanwhile, Lola and Carmen find themselves imprisoned in a dreary Spanish jail, enduring the harsh consequences of their choices. This chapter serves as a reminder of the price of their audacious actions.

Spanish Jail
12

Carmen’s Transformation

Years later, Carmen is released from jail, only to receive a surprising gift from the powers of the underworld. Elevated to a position of notable status, she is transformed back into a man, marking a radical new beginning in her eternal journey.

Hell

Last updated: November 18, 2024 at 20:23

Was this helpful?

Don't Tempt Me (2003) Timeline Questions Answered – Chronology FAQ

Find frequently asked questions about the Don't Tempt Me (2003) timeline, including chronological order, nonlinear jumps, cause-and-effect links, and scene sequence clarifications. This timeline FAQ helps explain when key events happen, how moments connect, and why the story unfolds in that specific order.

Q1

Why are both Heaven and Hell trying to save Manny?

A.

Heaven and Hell are engaged in a cosmic battle for Manny's soul. Lola, an angel, is sent by Marina to salvage Manny's troubled soul before he falls into darkness due to his brain injuries and despair. Simultaneously, Carmen, a demon, is tasked by Davenport to reinvigorate Manny's fighting spirit. However, Davenport later forms an alliance with Marina, arguing that humanity deserves freedom of choice, leading both realms to work toward Manny's redemption rather than competition.

heavenhellmannysoulcelestial battlelolacarmen
Q2

Why does Lola pretend to be Manny's wife?

A.

Lola takes on the guise of Manny's estranged wife as part of her angelic mission to salvage his soul. With Manny spiraling into despair due to his career-ending brain injuries and mounting financial troubles, Lola uses this disguise to reconnect him with his mother and reignite his will to live, appealing to his emotional core rather than his material desires.

lolamannywifedisguiseestrangedmission
Q3

Why does Carmen pretend to be Manny's cousin?

A.

Carmen, a demon from Hell, adopts the disguise of Manny's cousin to get close to him and become a significant part of her mission. By living in his flat and presenting herself as family, she aims to influence him to reclaim his boxing career, using his guilt and debt as motivation to get him back in the ring.

carmenmannycousindisguisedemonhell
Q4

Why do Lola and Carmen work at the hypermarket?

A.

Both celestial agents take low-paying jobs at a hypermarket to be near Manny and influence his life. Working together in the oppressive workplace allows them to bond over their shared disdain for management and empathize with struggling employees, gradually building trust while they pursue their separate missions to save him.

hypermarketlolacarmenjobworkplacemanny
Q5

Why do Heaven and Hell form an alliance in the movie?

A.

Davenport, facing pressure from Hell's internal management conflicts, reaches out to Marina in Heaven. They share a mutual recognition that neither realm can exist without the other, and they argue that humanity deserves freedom of choice. This unprecedented cooperation leads Davenport to instruct Carmen to work alongside Lola rather than against her.

davenportmarinaheavenhellalliancecooperation
Q6

Why do Lola and Carmen decide to rob the hypermarket?

A.

Desperate to free Manny from his crushing debts and boxing obligations, Lola and Carmen devise a heist to steal money from the hypermarket's cashier office. They hope the stolen cash will pay off Manny's debts to the corrupt police chief, allowing him to escape his despair and the dangerous thugs pursuing him.

heistrobberyhypermarketdebtmannymoney
Q7

What happens to Manny at the end?

A.

Manny sacrifices himself to help Lola and Carmen escape when they return to his apartment and are ambushed by the corrupt police chief. He is fatally injured in the act of saving them, but his selfless sacrifice allows him to ascend to Heaven, rewarded for his moral courage despite his previous struggles with despair.

mannydeathsacrificeheavenascendpolice chief
Q8

Why do Lola and Carmen end up in jail?

A.

After the failed heist at the hypermarket, Lola and Carmen are arrested and imprisoned in a Spanish jail. They must face harsh earthly consequences for their actions, even though their intentions were to help Manny. Their cosmic missions do not protect them from human law.

jailprisonlolacarmenheistarrestedconsequences
Q9

Why is Carmen transformed into a man at the end?

A.

After Carmen is released from jail, the powers of the underworld reward her for her role in Manny's redemption. She is elevated to a position of notable status in Hell, far beyond her previous role as a waitress, and is granted the transformation back into a man, marking a radical new chapter in her eternal existence.

carmentransformationgenderhellpromotionunderworld
Q10

Why does Manny sacrifice himself for Lola and Carmen?

A.

Manny sacrifices himself because he has finally found genuine connection and purpose through his relationships with Lola and Carmen. After living in despair, he chooses to act selflessly, helping the two women escape the deadly trap set by the corrupt police chief, which leads to his fatal injuries but also his redemption.

Earlier in the film, Manny is consumed by guilt and despair, feeling he has nothing left to live for. His transformation into someone willing to die for others shows his complete character arc.

mannysacrificedeathlolacarmenredemption
Q11

Who are the thugs pursuing Manny and why?

A.

Manny is relentlessly pursued by thugs sent by a corrupt police chief to whom he owes a significant debt. His mounting financial troubles and inability to pay what he owes have attracted dangerous collectors, and their threats worsen his mental state, pushing him further toward desperation.

thugsdebtpolice chiefmannymoneydanger
Q12

Why is Manny's boxing career destroyed?

A.

Manny's career was left in ruins due to severe brain damage sustained in his last fight. The injuries left him vulnerable, any additional hit could cause serious harm, and his physical decline mirrored his emotional descent into despair, making his situation increasingly precarious.

boxingbrain damageinjurymannycareerfight
Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems - dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private, always.

Explore Movie Threads

Discover curated groups of movies connected by mood, themes, and story style. Browse collections built around emotion, atmosphere, and narrative focus to easily find films that match what you feel like watching right now.

Movies with celestial bureaucracies like Don't Tempt Me

Stories where divine and demonic agents meddle in human lives.If you enjoyed the divine and demonic intrigue of Don't Tempt Me, this list features similar movies where Heaven and Hell's agents clash on Earth. Discover other surreal comedies and dramas that explore cosmic bureaucracy, moral ambiguity, and the whimsical battle for human souls.

surrealfantasticalsatiricalmorally ambiguouswhimsicalcerebralunconventional

Narrative Summary

These narratives typically involve agents from opposing cosmic realms (Heaven/Hell, Order/Chaos) being dispatched to influence a pivotal human subject. The story unfolds as a contest of wits and power, often revealing that the celestial systems are as flawed and complex as the humans they seek to judge, leading to unexpected alliances or philosophical revelations.

Why These Movies?

They are grouped by their unique premise of cosmic beings interacting with the human world, a shared tone that balances the whimsical or surreal with darker, more thoughtful themes, and a focus on the bureaucratic or systematic nature of good and evil.

Bittersweet cosmic morality tales like Don't Tempt Me

Where high-stakes divine conflicts lead to tragically hopeful endings.For viewers who liked the mixed emotions and cosmic stakes of Don't Tempt Me, this collection features movies where a human story is the fulcrum for a larger divine battle. Find similar films that explore sacrifice, redemption, and identity with a tone that is both darkly comedic and poignantly bittersweet.

bittersweetmorally ambiguoustragichopefultransformativephilosophicalsatirical

Narrative Summary

The narrative follows a collision between the cosmic and the human, where the fate of a mortal becomes the prize in a larger spiritual war. The human story often ends in tragedy or great cost, but this sacrifice catalyzes a meaningful, often positive, change or revelation for the supernatural characters, resulting in a mixed-feeling conclusion.

Why These Movies?

These films share a specific emotional pattern: they juxtapose high-concept fantasy with grounded human drama, leading to an ending that is neither fully happy nor sad. The focus is on the moral and emotional consequences for all characters involved, creating a unique, thought-provoking vibe.

Unlock the Full Story of Don't Tempt Me

Don't stop at just watching - explore Don't Tempt Me in full detail. From the complete plot summary and scene-by-scene timeline to character breakdowns, thematic analysis, and a deep dive into the ending - every page helps you truly understand what Don't Tempt Me is all about. Plus, discover what's next after the movie.

Don't Tempt Me Summary

Read a complete plot summary of Don't Tempt Me, including all key story points, character arcs, and turning points. This in-depth recap is ideal for understanding the narrative structure or reviewing what happened in the movie.

Don't Tempt Me Summary

Characters, Settings & Themes in Don't Tempt Me

Discover the characters, locations, and core themes that shape Don't Tempt Me. Get insights into symbolic elements, setting significance, and deeper narrative meaning - ideal for thematic analysis and movie breakdowns.

Characters, Settings & Themes in Don't Tempt Me

Don't Tempt Me Spoiler-Free Summary

Get a quick, spoiler-free overview of Don't Tempt Me that covers the main plot points and key details without revealing any major twists or spoilers. Perfect for those who want to know what to expect before diving in.

Don't Tempt Me Spoiler-Free Summary

More About Don't Tempt Me

Visit What's After the Movie to explore more about Don't Tempt Me: box office results, cast and crew info, production details, post-credit scenes, and external links - all in one place for movie fans and researchers.

More About Don't Tempt Me